(data stored in ACNUC7421 zone)

EMBL: CP002299.PE440

CP002299.PE440       Location/Qualifiers
FT   CDS_pept        537266..538792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0445"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: chu:CHU_3446 phytoene
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78528"
FT                   /db_xref="GOA:E3J9W6"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9W6"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ADP78528.1"
FT                   /translation="MFRTDVQNERPGTGPFDVAVIGGGPAGMATALRLQAAGVSTVVLE
FT                   AHGHVGGCAGYYRRRGFSFDVGATTLVDFAPGGVGAELIESVGLGPLDAQELPGYVAHL
FT                   PDRQVVLHRDQALWHAERLRALGDSDRHRRFWALLDRLARTFWRASRAGVRLPVRGPAD
FT                   ALHDLRAVGPAGVPLARYMTWTLGDALRRHRLRDDAALVGLLAMLVEDTVHASVDDAPL
FT                   INAALGVTIRGAGLSRHAGGMSGFWRALVAHYRRLGGQLRAGSPVSRVDGETGAYRLAT
FT                   RRGPVHARRIVAAVPAAATAAICAGLPVAGRLRPYLDRDADALGGACVMFLGVPDGEVA
FT                   GQELTHHQFLRSYDQPLGDGNNMFLSVSAAGDTLSAPPGHRAVMISTHTDLAGWAGLGP
FT                   AEYEQRKKWIGEVLVACARRAYPALGERAVIAETGTPRSYERFGFRPGGAVGGVRQRLG
FT                   NSNQHAIPHDLGGRGLWLVGDSTWPGLGTVACVLGSRIVADGMLRERGFA"
     atgttcagaa cggacgttca gaacgagcgg ccggggaccg ggccgttcga cgtggcggtg        60
     atcggcggtg gcccggccgg catggcgacc gcgctgcggc tgcaggccgc gggcgtctcg       120
     acggtggtgc tggaggccca tggccacgtc ggcggctgcg cgggctacta ccgcaggcgg       180
     ggcttctcgt tcgacgtcgg cgcgaccacg ctcgtcgact tcgcgcccgg gggagtcggc       240
     gccgagctga tcgagtcggt ggggctgggc ccactggacg cgcaggagct gccgggctac       300
     gtcgcgcacc tgcccgatcg ccaggtcgtg ctgcaccggg accaggcgct gtggcacgcc       360
     gagcggctgc gcgcgctcgg cgactccgac cgccaccggc gcttctgggc gctgctcgat       420
     cggctggcgc ggacgttctg gcgggcgagc cgggccgggg tgcgcctccc ggtccggggg       480
     ccggccgacg cgctgcacga cctgcgcgcc gtcggcccgg ccggcgtgcc gctcgcgcgt       540
     tacatgacct ggacgctcgg ggacgcgctg cgccggcacc gcctgcgcga cgatgccgcg       600
     ctcgtcgggc tgctcgcgat gctggtcgag gacaccgtgc acgcgtccgt cgacgacgcg       660
     ccgctgatca acgccgcgct cggcgtgacg atccggggcg ccgggctcag ccgccacgcc       720
     ggcggcatga gcggcttctg gcgcgcactc gtggcgcact accgaaggct tggcggccag       780
     ctgcgggcgg gcagcccggt ctcgcgcgtc gacggcgaga cgggcgccta ccggttggcg       840
     acccggcggg gcccggtcca cgcccgccgg atcgtggccg cggtgcccgc cgcggccacg       900
     gccgcgatct gcgcgggcct tccggtcgcc ggccggctgc gtccgtacct ggaccgtgac       960
     gcggacgcgc tcggtggcgc gtgcgtgatg ttcctgggcg tgcccgacgg cgaggtggcc      1020
     gggcaggagc tcacccacca ccagttcctg cggtcgtacg accagccgct gggcgacggg      1080
     aacaacatgt tcctctccgt ctccgcggcc ggggacaccc tcagcgcgcc gccgggccac      1140
     cgcgcggtca tgatctccac ccacaccgat ctggccggct gggcggggct cggcccggcc      1200
     gagtacgagc agcgcaagaa gtggatcggc gaggtgctcg tcgcctgcgc gcggcgtgcc      1260
     tacccggcgc tcggggaacg ggccgtgatc gccgagacgg gcaccccgcg cagttacgaa      1320
     cggttcgggt tccggccggg tggcgcggtg ggtggcgtcc gccagcgcct gggcaactcc      1380
     aaccagcacg ccatcccgca cgacctgggt ggccgcggcc tctggctggt cggtgactcg      1440
     acctggcctg gcctcggcac ggtggcctgc gtgctgggca gccgcatcgt cgcggacggg      1500
     atgctgcgcg aacggggatt cgcctga                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page