(data stored in ACNUC7421 zone)

EMBL: CP002299.PE443

CP002299.PE443       Location/Qualifiers
FT   CDS_pept        541261..542529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0448"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cel:T28H11.1 Sperm-Specific family, class Q"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78531"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9W9"
FT                   /inference="similar to AA sequence:KEGG:T28H11.1"
FT                   /protein_id="ADP78531.1"
FT                   /translation="MTFYPRNAALRVGTLLGGPVLAAAVLTASPATAAPASPQAIPPIL
FT                   LAGDQSQTGAVDISPTGVVVGTTQAPPPANIPGGTSPSTPLRWLPTPTGYVKQTLSLPA
FT                   GATSATVTGVTDLGEAGGTLTTAAGQQPVRWSVSGLQTTALGPPGSSTTTAVGPGHWAV
FT                   ETGDTISGTATLFARDGSTTALAGTPELAGARIVTAVSIGGPGTVLLGAISGVGMGTTG
FT                   RAVVWRSGSTVSLPVISAFSIGSACLSAIQPDGSVAYSGVVINPAPAQVIGVHRGGVPG
FT                   TEVALPTGGRTATLGCSPAGGPVDALASDGSVVGQLLAAPGQPAEAALWRDGALVPLGV
FT                   AAGETATTAAAVASGGRVILVATTTAGVQQPYLWTNGVRVPLTLPAGWTLRTIVKFTDA
FT                   GAVLGAVQNAAGDIRPVVWRTRG"
     gtgaccttct acccacgcaa tgccgcgtta cgtgttggca ccttgttggg cgggccggtg        60
     ctcgccgccg ccgtcctcac cgcgtcgccg gcgacggccg cgccggcgtc gccccaggcg       120
     atcccgccga tcctgctggc cggcgaccag tcgcagaccg gcgctgtcga catctccccg       180
     accggggtgg tcgtcggcac cacccaggcc ccaccgccgg cgaacatccc cggcgggacc       240
     tcgccgagca cgccgctgcg ctggctgccc accccgaccg gctacgtcaa gcagacgctc       300
     agcctgccgg ccggcgccac cagcgcgacc gtcacgggcg tcaccgacct cggggaggcc       360
     ggggggacgc tgaccacggc agccggccag cagccggtgc gctggtccgt ctccggcctg       420
     cagaccaccg cgctcgggcc gcccggcagc tcgacgacca ccgccgtcgg ccctggccac       480
     tgggcggtcg agaccggtga cacgatcagc ggcaccgcga cgctcttcgc gcgggacggc       540
     agcacgaccg cgctggccgg aacgccggag ctggcgggcg cccggatcgt gaccgcggtg       600
     tccatcggcg gccccggcac ggtcctgctc ggcgcgatca gcggtgtcgg gatgggcacc       660
     acgggccgcg cggtcgtgtg gcggtccggc tcgacggtgt cgctgccggt gatctccgcc       720
     ttctcgatcg gctcggcctg cctgtcggcg atccagccgg acggttcggt cgcctacagc       780
     ggcgtcgtca tcaacccggc ccccgcccag gtcatcgggg tgcatcgcgg cggcgtcccc       840
     ggtaccgagg tcgcgctgcc gaccggcggc cggacggcga cgctcgggtg ctcgcccgcg       900
     ggtgggcccg tggacgcgct cgccagtgac ggctccgtgg tcggtcagct gctcgccgct       960
     cccggacagc ccgccgaggc cgcgctgtgg cgcgacggtg cgctggtgcc gctcggggtg      1020
     gcggccggcg agaccgccac caccgcggcg gccgtcgcga gcggcggccg ggtcatcctg      1080
     gtcgcgacga ccacggccgg cgttcagcag ccctacctgt ggacgaacgg cgtccgcgtc      1140
     ccgctgacgc tgcccgccgg ctggaccctg cgcaccatcg tcaagttcac cgacgccggc      1200
     gccgtcctgg gagccgttca gaacgcggct ggcgacattc gtcccgtcgt ctggcgcacc      1260
     cggggctaa                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page