(data stored in ACNUC7421 zone)

EMBL: CP002299.PE446

CP002299.PE446       Location/Qualifiers
FT   CDS_pept        545624..545785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_6930 PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78534"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9X2"
FT                   /inference="similar to AA sequence:KEGG:Amir_6930"
FT                   /protein_id="ADP78534.1"
FT                   /translation="MRFVSEWWPARLVASPAGPDPGRKGRNSADFGSTSVPGLAFVSEA
FT                   TVPQRRTR"
     atgcggttcg tgtcggagtg gtggcccgcg cgcctcgtcg cctcgcccgc cgggccggac        60
     ccgggccgca agggccgaaa ttccgccgat ttcggctcaa cctccgtgcc ggggctcgcg       120
     tttgtaagtg aggcaaccgt gccccagagg aggacgcgat ga                          162
//

If you have problems or comments...

PBIL Back to PBIL home page