(data stored in ACNUC7421 zone)

EMBL: CP002299.PE447

CP002299.PE447       Location/Qualifiers
FT   CDS_pept        545782..546666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6489 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78535"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9X3"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6489"
FT                   /protein_id="ADP78535.1"
FT                   /translation="MTMSDRSGRNLIASSARTRWKRRLTGLALLVAGAAAVIPAQGALA
FT                   AGNGPQPPSTRVDAAIKAAYLQAFTGGQNQAHNLAAVEDGPALASTLALAEQNFPAATS
FT                   PSQVTVSGIKIKGPAKAALRFDVVYQGGYDIGQRDGTAVVVDRQWKVSRDTFCSVLSLA
FT                   GAVCPPKAGRPPRDPAAARLAIQQAYTRAFTGGEDPAYSLGAVEDGPALAGTLAQAMQN
FT                   FPGATSTAAVTTGDIVFTSPRSAALPFHITYQQGADFGVQNGTAVIVGGQWKVSRQTYC
FT                   TVMGWAGATCPAP"
     atgacgatgt ccgaccgatc agggagaaat ctgatcgcca gttctgcgcg aaccaggtgg        60
     aagagacgtc tgaccgggct ggccctgctt gtcgccggcg ccgccgcggt gattcccgca       120
     cagggagcgc tggcggccgg aaacgggccc cagccgcctt ctacccgggt ggatgccgca       180
     atcaaggccg cctacctgca ggcattcacc ggtggtcaga atcaggccca caatctcgcc       240
     gcggtcgagg acggcccggc gctggccagc accctcgcgc tggccgagca gaacttcccg       300
     gcggccacca gcccgtccca ggtgacggtc tcgggtatca agatcaaggg gccggcgaag       360
     gcggcgttgc gtttcgacgt cgtctaccag ggcggttatg acatcggcca gcgggacggc       420
     acggccgttg tcgtcgaccg tcagtggaag gtcagccggg acaccttctg ctccgtgctg       480
     agcctcgcgg gcgccgtctg cccgccgaag gcgggacgtc cgccccgcga cccggccgct       540
     gcccggctgg ccatccagca ggcctatacg cgggcgttca ccggtggcga ggacccggcc       600
     tacagtctcg gcgcggtgga ggacggcccg gcgctcgccg gcacgctggc gcaggcgatg       660
     cagaacttcc ccggtgctac gtcgaccgcc gcggtgacga ccggcgacat cgtcttcacc       720
     agtccgcgca gtgcggcgct cccgttccac atcacctatc aacagggtgc cgacttcggc       780
     gtgcagaacg gcaccgccgt catcgtcggt ggccagtgga aggtcagccg gcagacctac       840
     tgcaccgtga tgggctgggc cggcgccacc tgcccggccc cgtga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page