(data stored in ACNUC7421 zone)

EMBL: CP002299.PE45

CP002299.PE45        Location/Qualifiers
FT   CDS_pept        complement(50278..51627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0045"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; Methyltransferase type
FT                   11; KEGG: cwo:Cwoe_1969 OsmC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78133"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E3J295"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ADP78133.1"
FT                   /translation="MVAPAETAAVRPTPPTHSYSVTCEWSGSTGVGYDRYSRAHVGHAP
FT                   PAATAVRLSSDPAFRGDPSLLNPEQLVVLAAASCQLLAFLAIAARARVDVRDYQDTGSA
FT                   VMTEDGRGGGAITEITLRPRITVVTDATEERLRRLAQLAHEQCFIAASLNCPVNVSPTF
FT                   EILTPYAFRDTDTAARRLALVSDVFDPGSRAFIHDRVRAAGLSDVRLAVDLGCGPGHTT
FT                   RLLAAATGAARTVGLDASTAFVATAVGTEPVSAQGGGLSADGATELAFLRHDVSRLPFP
FT                   AQARKADVVYARLLLPHLVDVTDAIGGWITQVAPHGLLLLDEVESIDTDQPALAAYLDH
FT                   ARHLLAARGTTLHAGRLVNTALHDLAAHSPGTSFEVEYNATEPVRPPVPAAAEMFGLNL
FT                   AVWRDDPLYRDRQPELDRLAADLAALAAGPEHDGHITWTMRRVAVRRLAG"
     atggtcgctc cagccgagac cgcagccgtc cgtcccacgc cgccgacgca cagctactcc        60
     gtcacctgcg agtggtcggg ctcgaccggg gtcgggtacg accggtactc ccgggcgcac       120
     gtcgggcacg caccccctgc ggccacggcg gtccggctgt cctccgaccc cgccttccgg       180
     ggcgacccgt cgctgctcaa ccccgagcag ctggtcgtgc tcgcggcggc gtcctgccag       240
     ctgctggcct tcctggcgat tgccgcgcgg gcccgggtcg acgtccggga ctaccaggac       300
     accggctccg cggtgatgac cgaggacggc cggggcggcg gcgcgatcac cgagatcacc       360
     ctgcggcccc ggatcaccgt cgtcaccgac gccaccgagg agaggctgcg caggctcgcc       420
     cagctggccc acgagcagtg cttcatcgcc gcgtcgctga actgcccggt caacgtctcc       480
     ccgacgttcg agatcctcac cccgtacgcg ttccgggaca ccgacacggc ggcccgccgg       540
     ctcgcgctgg tctccgacgt cttcgatccc ggctcccgtg ccttcatcca cgaccgggtc       600
     cgtgccgccg gcctgtccga cgtccggctc gcggtcgatc tcggctgcgg gccgggccac       660
     accacccggc tgctggccgc cgcgaccggc gcggcccgca ccgtcgggct ggacgcgtcc       720
     acggcgttcg tcgccaccgc cgtcggcacc gagccggtgt ccgcacaagg cggtggcctg       780
     agcgccgacg gcgccaccga gctggccttc ctgcgtcacg acgtcagccg gctcccgttc       840
     ccggcccagg cacgcaaggc cgacgtcgtc tacgcccggc tgctgctgcc ccacctcgtc       900
     gacgtcacgg acgcgatcgg cgggtggatc acccaggtcg ccccgcacgg cctgctcctg       960
     ctcgacgagg tcgagtcgat cgacaccgac cagccggcac tcgcggccta cctcgaccac      1020
     gcccgccacc tgctggccgc ccgcggcacg accctgcacg ccgggcggct ggtgaacacc      1080
     gccctgcacg acctcgccgc gcacagcccg gggacgtcct tcgaggtcga gtacaacgcc      1140
     accgagccgg tccgcccgcc ggtcccggcc gcggcggaga tgttcggcct caacctggcc      1200
     gtctggcgcg acgaccccct ctaccgcgac cgccagcccg agctcgaccg gctggccgcc      1260
     gacctcgcgg ccctcgccgc cggcccggag cacgacggtc acatcacctg gacgatgcgc      1320
     cgcgtggccg tccgccgcct ggccggctag                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page