(data stored in ACNUC7421 zone)

EMBL: CP002299.PE450

CP002299.PE450       Location/Qualifiers
FT   CDS_pept        complement(551428..552060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0455"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   rpf:Rpic12D_3499 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78538"
FT                   /db_xref="GOA:E3J9X6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9X6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADP78538.1"
FT                   /translation="MPTEEPSRPYHHGHLREALVEAGVGLARTGGPEAVVLRSATRAAG
FT                   VSHNAAYRHFDDRDELLRAVCERCMSQLAQLMEARIDAVPLEGDPVADAWLRLGALGSA
FT                   YVEFATSEPGWFRTAFAVPRTTHMFQPGEGVGNCGLGPYEMLGAGLDELVRVGAIPAER
FT                   RPGAEYVAWSAVHGLSSLIIDGPLRELPDDERARALDTVLEAVVRGL"
     atgccaaccg aagaaccgag ccgcccgtac caccacggtc atctgcggga ggcactcgtc        60
     gaggccgggg tcgggctggc ccggaccggg ggccccgagg ctgtcgtgct gcgctcggcg       120
     acgcgggccg ccggggtctc acacaacgcg gcctaccggc acttcgacga ccgggacgag       180
     ctgctgcggg ccgtgtgcga acgatgcatg agccagctgg cccagctcat ggaggcccgg       240
     atcgacgccg tgcccttgga gggcgacccg gtggcggacg cctggctcag gctcggggcg       300
     ctcggcagcg cctacgtcga gttcgccacc tcggaacccg gctggttccg gacggcgttc       360
     gcggtgccgc gcaccacgca catgttccag cccggcgaag gagtcgggaa ctgcgggctc       420
     ggcccctacg agatgctcgg cgccgggctc gacgagctgg tccgggtggg cgcgatccca       480
     gccgaacgcc gacccggcgc cgagtacgtg gcctggtcgg ccgtacatgg cctgtcgagc       540
     ctgatcatcg acggcccgct acgcgagctt cccgacgacg agcgagcccg cgccctcgac       600
     accgtcctcg aggccgtcgt ccgggggctg tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page