(data stored in ACNUC7421 zone)

EMBL: CP002299.PE451

CP002299.PE451       Location/Qualifiers
FT   CDS_pept        552133..553689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0456"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="KEGG: nfa:nfa14430 putative transporter; TIGRFAM:
FT                   drug resistance transporter, EmrB/QacA subfamily; PFAM:
FT                   major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78539"
FT                   /db_xref="GOA:E3J9X7"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9X7"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADP78539.1"
FT                   /translation="MPSMSPRRRLAVLVTVCLAVFAINLDTTIVNVALPDLARQLGATT
FT                   RDLQWIVDGYNLAFAALVLTAGSIGDRFGRRPVLLGGLVGFALMSGIGALCDGAGALVA
FT                   VRFVMGAFAALIFPTTLSIITNAYPDRAERAKAIGVWGAVTGLGVAIGPVTGGLLLAHF
FT                   WWGSVFVALVPVALVAAVLAFVLVPESSDPAAARLDLPGLVTSSAAIGLLVYTIIEAPD
FT                   RGWTSALTLGGFAVTAAVAAAFVMLERRHPAPMLDVSLFRTPAFSAASGAVTVAFFALF
FT                   GFIFLITQYFQFIRGFGTVSTGVRILPVALTIALGSVTGTLLAGRLGTRTIVVTGLVLF
FT                   GGSFAWIAVSSTYQPYLQIAAQMVLMGTGLGLTTAPATESILSVLPAAKAGVGSAVNDA
FT                   TREAGGTLGVAVIGSVFTSIYTHHLAGTAVAALPAQAANAARDSVGAAFQVASQAGPAL
FT                   RDQLVSDVNASFMSGLHIACFVAAGVCWLGALGALALPGRRGMHAPQAEPAVAPEAAAA
FT                   V"
     gtgccgtcca tgagcccccg ccgccggctc gcggtcctcg tgaccgtctg cctggccgtc        60
     ttcgcgatca acctggacac cacgatcgtc aacgtcgctc tgccggacct cgcccgccag       120
     ctcggggcga ccaccaggga cctgcagtgg atcgtcgacg gctacaacct ggccttcgcc       180
     gccctcgtgc tcaccgccgg ctcgatcgga gaccggttcg gccggcggcc ggtgctgctc       240
     ggcgggctcg tcggcttcgc gctgatgagc gggatcgggg cgctgtgcga cggcgccggc       300
     gcgctggtgg cggtgcgctt cgtcatgggg gcgttcgccg cgctgatctt cccgacgacc       360
     ctgtcgatca tcaccaacgc ctaccccgac cgggccgagc gggccaaggc gatcggcgtg       420
     tggggcgccg tcaccggcct cggcgtcgcg atcggtcccg tcaccggtgg gctgttgctc       480
     gcccacttct ggtggggcag cgtcttcgtc gcgctcgtcc cggtcgccct ggtcgcggcc       540
     gtgctcgcgt tcgtgctggt gccggagtcc tccgacccgg ccgccgcccg gctcgacctg       600
     cccggcctgg tgacgtcctc ggccgccatc gggctgctcg tctacacgat catcgaggcg       660
     ccggaccgcg gctggacctc ggccctgacc ctgggcgggt tcgccgtcac cgccgccgtc       720
     gcggccgcgt tcgtcatgct ggagcggcgc cacccggccc cgatgctcga cgtgtccctg       780
     ttccggacgc cggccttctc ggccgccagc ggtgcggtga ccgtcgcgtt cttcgcgctc       840
     ttcgggttca tcttcctgat cacgcagtac ttccagttca tccgcgggtt cggcaccgtc       900
     tcgaccggag tccggatcct gccggtggca ctcaccatcg cgctcggatc ggtgaccggc       960
     accctgctgg ccggccggct cggcaccagg accatcgtcg tcaccggtct ggtgctgttc      1020
     ggcggctcgt tcgcgtggat cgcggtgtcc agcacctacc agccgtacct gcagatcgcg      1080
     gcccagatgg ttctcatggg caccggcctg ggcctgacca cggccccggc caccgagtcg      1140
     atcctcagcg tgctgcccgc cgcgaaggcc ggtgtcgggt cggcggtcaa cgacgccacc      1200
     cgcgaggccg ggggcacgct cggggtcgcc gtcatcggca gcgtcttcac ctcgatctac      1260
     acccaccacc tggccggcac ggcggtcgcc gcgctgccgg cccaggcggc gaacgcggcg      1320
     cgcgactccg tcggggccgc gttccaggtc gccagccagg ccggccccgc gctacgggac      1380
     cagctcgtct ccgacgtcaa cgcgtcgttc atgagcggcc tgcacatcgc ctgcttcgtc      1440
     gcggccggcg tctgctggct gggcgctctc ggcgcgctcg cgctgcccgg ccgccggggc      1500
     atgcacgccc cgcaggccga gccggcggtg gctcccgagg cggcggccgc cgtctga         1557
//

If you have problems or comments...

PBIL Back to PBIL home page