(data stored in ACNUC7421 zone)

EMBL: CP002299.PE455

CP002299.PE455       Location/Qualifiers
FT   CDS_pept        557369..557878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0460"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: tcu:Tcur_0029 pyridoxamine 5'-phosphate
FT                   oxidase-related FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78543"
FT                   /db_xref="GOA:E3J9Y1"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Y1"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADP78543.1"
FT                   /translation="MTTPTTRLDRPYSAPSAVAVSWEQAEAVLRDAELSWISTVRPDGG
FT                   PHVTPLVAVWLDGALYFHTGAQEQKYANLRANPRVVLTTGAATWDHGIDVVVEGEAVPA
FT                   TDEAILTRLAAAFATKWDGRWRLSARDGHLVNADMGGVSEAFEVRPTRAYAHTKGEPFS
FT                   QTTYTF"
     atgacaacgc cgaccacccg gctcgaccgt ccctacagcg cgcccagtgc cgtcgccgtc        60
     agctgggagc aggccgaggc cgtgctgcgt gacgcggaac tcagctggat ctccacggtg       120
     aggcccgacg gagggccgca cgtgaccccg cttgtcgccg tctggctcga cggggcgctg       180
     tacttccaca cgggcgccca ggagcagaag tacgccaacc tgcgggcgaa cccgcgcgtc       240
     gtcctcacca ccggcgcggc cacctgggat cacggcatcg acgtggtggt cgagggcgag       300
     gccgtccccg ccaccgatga ggcgatcctc acccggctcg cggccgcgtt cgccaccaag       360
     tgggacggcc gctggcggct ctccgcccgc gacgggcacc tcgtcaacgc cgacatgggc       420
     ggggtcagcg aggcgttcga ggtccggccg acgcgggcgt acgcgcacac caagggtgag       480
     ccgttcagcc agacgaccta taccttctga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page