(data stored in ACNUC7421 zone)

EMBL: CP002299.PE464

CP002299.PE464       Location/Qualifiers
FT   CDS_pept        568986..569612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0469"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78552"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Z0"
FT                   /inference="similar to AA sequence:KEGG:Sare_0339"
FT                   /protein_id="ADP78552.1"
FT                   /translation="MIPDGQLVAEPVGATVGGARRWRWLVALSLVVLLGLLLADRLLVG
FT                   VVEDRLSARLSCLGALTGTRTVHIGGFPFLTQMAEGHYRVVTVTADGVGASARLTDVDV
FT                   TFHDVRMRPLAGLVGRSAPGSITVGSISARATVMFGSAGPASGLGAGDALLDAAGSGRL
FT                   DEPIARLAGLPFPVHLDGAQPVPGGVRVALSVPGTAISGVGRCQS"
     gtgatacccg acggacagct cgtggccgag ccggtcggcg cgacggtcgg cggcgctcgg        60
     cgctggcgct ggctcgtggc gctgtcactc gtcgtcctgc tcggcttgct gctggccgac       120
     cggctgctgg tcggcgtcgt cgaggaccgg ctgtcggccc ggctgtcctg cctgggcgcg       180
     ctgaccggaa cccggacggt gcacatcggc ggattcccgt tcctcaccca gatggccgag       240
     gggcattacc gggtggtgac ggtgacggct gacggcgtcg gcgcgtcggc ccggctgacc       300
     gacgtcgacg tgaccttcca cgacgtccga atgcggccgt tggccggcct cgtcggccgg       360
     tcggctcccg gctcgatcac ggtcggctcg atctcagcgc gggccacggt catgtttggc       420
     tcggcgggcc ctgcctccgg actcggcgcg ggagacgcgc tgctcgacgc ggccggctcg       480
     gggcgactcg acgaaccgat cgcgcggttg gctggccttc cgttcccggt tcaccttgac       540
     ggcgcccagc ctgtgccggg cggggtgcgg gtcgcgttgt cggtcccggg cacggcgatc       600
     agcggcgttg gccgctgcca aagctaa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page