(data stored in ACNUC7421 zone)

EMBL: CP002299.PE465

CP002299.PE465       Location/Qualifiers
FT   CDS_pept        complement(569696..570502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0470"
FT                   /product="precorrin-6x reductase"
FT                   /EC_number="1.3.1.54"
FT                   /note="TIGRFAM: precorrin-6x reductase; KEGG: rop:ROP_05640
FT                   precorrin-6X reductase; PFAM: Precorrin-6x reductase
FT                   CbiJ/CobK"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78553"
FT                   /db_xref="GOA:E3J9Z1"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Z1"
FT                   /inference="protein motif:TFAM:TIGR00715"
FT                   /protein_id="ADP78553.1"
FT                   /translation="MRVLILGGTREARDLAALLVAEPGMVVTTSLAGRVRDPALPAGEI
FT                   VIGGFGGVAGLRAFLRDRAIDVVVDATHPFATTMSEHAVAVCVGPPDDAPPTAPGAGVP
FT                   LVRLARPGWTERPGDGWHRVADLRTAADQARALCPPGGAVFVTTGRRQLAPFAADPYRH
FT                   YVIRAVDPPTDVLPPRHTVLLDRGPYTVEGETRLMRDHGVRVLVTKDSGGALTAAKLDA
FT                   ARALGLPVVMVDRPALTDPAPPTWSNVAGVLGALHALASSQRPGAR"
     gtgcgtgtcc tgatcctcgg cggtacccgg gaggcccgtg acctggccgc cctgctcgtc        60
     gcggagccgg ggatggtcgt gaccacgtcg ctcgccggcc gggtccgcga cccggcgctg       120
     cccgccggcg agatcgtgat cggcggcttc ggtggcgtcg ccgggctgcg cgccttcctg       180
     cgcgaccgcg cgatcgacgt cgtcgtcgac gccacccacc cgttcgccac gacgatgtcc       240
     gagcacgccg tcgccgtgtg cgtcgggccg cccgacgacg cgccgccaac cgcgccgggc       300
     gccggtgtgc cgcttgtgcg gctggcccgg ccgggctgga ccgagcgccc cggcgacggc       360
     tggcaccgcg tcgcggatct ccggacggcg gccgaccagg cccgcgcgct gtgcccgccg       420
     ggtggcgccg tgttcgtcac caccggccgc cgccagctcg cgccgttcgc cgccgacccc       480
     taccgccatt acgtgatcag ggcggtcgac ccgccgaccg acgtgctgcc gccccggcac       540
     accgtgctgc tcgaccgcgg cccgtacacg gtcgagggcg agacccggct gatgcgcgac       600
     cacggcgtcc gggtcctggt gaccaaggac agcggcggcg ccctgaccgc ggcgaagctg       660
     gacgcggccc gagccctcgg cctgccggtc gtcatggtcg accggcctgc tctgaccgac       720
     ccggcgccac ccacctggtc gaacgtcgcc ggggtgctcg gcgccctgca cgcgctcgcc       780
     tcctcccagc ggcccggcgc ccgttag                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page