(data stored in ACNUC7421 zone)

EMBL: CP002299.PE466

CP002299.PE466       Location/Qualifiers
FT   CDS_pept        complement(570490..571242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0471"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="TIGRFAM: precorrin-4 C11-methyltransferase; KEGG:
FT                   ami:Amir_1779 precorrin-4 C11-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78554"
FT                   /db_xref="GOA:E3J9Z2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Z2"
FT                   /inference="protein motif:TFAM:TIGR01465"
FT                   /protein_id="ADP78554.1"
FT                   /translation="MTVHFIGAGPGAADLITLRARDLIAASPVCLYAGSLVDPAVLAHC
FT                   PPGARLVDTARLTLDEIVGHLVEADAAGQDVARLCSGDPSVFSAVAEQMRRLDAAGVRY
FT                   DVCPGVSAYAAAAAELNRELTVPGVAQSVVLTRTSENASAMPAGETLAALGAAQATMVI
FT                   HLSVQRIEAVVAELLPVYGADTPVAVVAWASRPDQVVLRGRLDGIAPAVRAAGIRRAAV
FT                   IIVGAALAAEGFRDSHLYSVERDRACVS"
     atgaccgtcc acttcatcgg cgccgggccc ggcgcggccg atctgatcac gctgcgcgcc        60
     cgtgacctga tcgcggcctc gccggtctgc ctgtacgccg gcagcctcgt agacccggcc       120
     gtgctggcgc actgcccgcc cggtgccagg ctggtcgaca ccgcccggct gaccctggac       180
     gagatcgtcg gccacctcgt cgaggccgac gccgcagggc aggacgtcgc ccggctgtgc       240
     agcggcgacc cgtcggtgtt cagcgccgtc gccgagcaga tgcgccggct cgacgcggcc       300
     ggcgtccgct acgacgtctg cccgggcgtg tccgcgtacg cggcggcggc ggcggagctg       360
     aaccgggagc tgaccgtccc gggcgtcgcg cagagcgtgg tgctgacccg gaccagcgag       420
     aacgcctcgg ccatgcccgc cggggagacg ctcgcggcac tcggcgccgc ccaggcgacg       480
     atggtcatcc acctgtcggt gcagcggatc gaggcggtcg tcgccgagct gctcccggtc       540
     tacggcgcgg acaccccggt cgctgtggtc gcctgggcgt cgcggcccga ccaggtcgtg       600
     ctgcgcggcc ggctcgacgg catcgctccc gcggtccgcg ccgccgggat tcgccgggcc       660
     gcggtcatca tcgtcggcgc cgcgctggcg gccgagggct tccgggacag ccacctgtac       720
     tcggtggaac gagaccgcgc gtgcgtgtcc tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page