(data stored in ACNUC7421 zone)

EMBL: CP002299.PE467

CP002299.PE467       Location/Qualifiers
FT   CDS_pept        complement(571239..572525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0472"
FT                   /product="precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /EC_number="2.1.1.132"
FT                   /note="TIGRFAM: precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit; precorrin-6Y
FT                   C5,15-methyltransferase (decarboxylating), CbiT subunit;
FT                   KEGG: sen:SACE_5944 precorrin-6Y C(5,15)-methyltransferase
FT                   (decarboxylating); PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78555"
FT                   /db_xref="GOA:E3J9Z3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Z3"
FT                   /inference="protein motif:TFAM:TIGR02467"
FT                   /protein_id="ADP78555.1"
FT                   /translation="MTGGFGVTVVGIGEDGWDGLGQPARAALAAADVVLGGARQLGLVA
FT                   GRVRAVETWPRDLAAAAAALPDSHAGQRVAVLASGDPMHYGVGGTLTRALGPGQVRVLP
FT                   APSSISLACARLGWPVEEVAVVSAVGRPYAAVGAELRADARVLVLTGDEDGADRVGRLV
FT                   AERGLDAELTVLERLGGPRERVGRHPGRPGIPPHDRLAIVAVRCGPDSTHESQAVASRA
FT                   PGLPDDTFATDGVLTKQEVRAVTLAALAPAPGELLWDVGAGSGGITTEWLRADRRCRAV
FT                   AIEPRADRAAHVRANAERLAGAVEQTAGLATAAGGLRVVEGRAPAALAGLPRPDAVFVG
FT                   GGASVAGVIETCLAALRPGGRLVANAVTIETEAMLADWHRRAGGRLRRIAISHAEPVGS
FT                   FTAFRPALPVTQWVHTAPVHTAQEKRATR"
     gtgaccggcg ggttcggcgt gacggtggtc ggcatcggcg aggacggctg ggacggtctc        60
     ggccaaccgg cccgggcggc gctcgccgcc gcggatgtcg tgctcggcgg cgcccggcag       120
     ctgggcctcg tggccggccg ggtccgggcc gtggagacct ggccccgcga cctggctgcc       180
     gccgcggcgg cgctgcccga cagccatgcc ggccaacggg tcgccgtcct cgccagcggc       240
     gacccgatgc actacggcgt cggcggcacg ctcacgcggg cgctgggacc gggccaggtc       300
     cgggtcctgc cggccccgtc gtcgatctcg ctggcctgcg cccggctcgg ctggccggtc       360
     gaggaggtcg ccgtcgtcag cgcggtcggc cggccgtacg ccgcggtcgg cgccgagctg       420
     cgcgccgacg cgcgggtgct ggtcctgact ggcgacgagg acggcgccga ccgggtcggt       480
     cggctggtcg ccgagcgcgg cctcgacgcc gagctcaccg tgctggaacg cctcggcggc       540
     ccgcgcgaac gggtcgggcg ccatccaggt cggcccggga taccgccaca cgaccggctc       600
     gccatcgtcg cggtccgctg cgggccggac tcgacgcacg agagccaggc ggtggccagc       660
     cgggcgccag ggctgcccga cgacacgttc gccaccgacg gcgtgctgac gaagcaggag       720
     gtccgggccg tcacgctggc agcgctcgct ccggcgcccg gcgagctgct ctgggacgtc       780
     ggggccggca gcggcggcat caccaccgaa tggctacggg ccgaccgccg gtgccgagcg       840
     gtcgcgatcg agccgcgggc cgaccgggcc gcccatgtgc gcgcgaacgc cgaacggctc       900
     gccggtgccg tcgaacagac cgcgggcctc gccaccgcgg cgggcggact acgcgtcgtg       960
     gagggccgcg cgccagccgc gctcgccggc ctgcccaggc ccgacgccgt cttcgtcggc      1020
     ggcggcgcca gcgtcgcagg cgtcatcgag acctgtctcg cggcgctgcg gcccggcggg      1080
     cgcctcgtcg ccaacgcggt cacgatcgag accgaggcca tgctcgccga ctggcaccgc      1140
     cgcgccggcg gccggctgcg ccggatcgcg atctcccatg ccgagccggt cggttcgttc      1200
     accgcgttcc gaccggcgct gcccgtcacg caatgggtcc acaccgcgcc ggtccacacc      1260
     gcgcaagaaa agagagcgac gcgatga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page