(data stored in ACNUC7421 zone)

EMBL: CP002299.PE469

CP002299.PE469       Location/Qualifiers
FT   CDS_pept        575093..575707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0474"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="TIGRFAM: cob(I)alamin adenosyltransferase; KEGG:
FT                   cai:Caci_6038 cob(I)alamin adenosyltransferase; PFAM:
FT                   ATP:corrinoid adenosyltransferase BtuR/CobO/CobP"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78557"
FT                   /db_xref="GOA:E3J9Z5"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Z5"
FT                   /inference="protein motif:TFAM:TIGR00708"
FT                   /protein_id="ADP78557.1"
FT                   /translation="MAPQGQVESVPADGLTTRQRRNRPLLVVHTGDMKGKSTAAFGLAL
FT                   RGWNQGWPIGVFQFVKSKKWKVGEENALLALGRLHEQTGEGGSVDWFKMGSGWSWTQRG
FT                   PQDDHAAAAAEGWERIKADLAAQTYGLLVLDEFTYVMEWGWVDVEDVVETLAARPGFQH
FT                   VVITGRRAHPRLIEVADLVVEMTKVKHPMDAGQKGQRGIEW"
     atggcgccgc agggccaggt cgagagcgtc cccgccgacg ggctgaccac tcggcagcgg        60
     cgcaaccggc cgctgctcgt cgtccacacc ggcgacatga agggcaagtc gacggccgcc       120
     ttcgggctcg cgctgcgggg ctggaaccag ggctggccga tcggcgtgtt ccagttcgtc       180
     aagagcaaga aatggaaggt cggcgaggag aacgcgctgc tggcgctcgg ccggctgcac       240
     gagcagaccg gcgagggcgg gtccgtcgac tggttcaaga tgggctccgg ctggtcctgg       300
     acccagcgtg gcccgcagga cgaccatgcc gcggccgccg ccgagggctg ggagcggatc       360
     aaggcggacc tcgccgcgca gacctacggc ctgctggtgc tcgacgagtt cacctacgtc       420
     atggagtggg gctgggtcga cgtcgaggac gtggtcgaga cgctggccgc gcgccccggc       480
     ttccagcacg tcgtcatcac cggccgccgg gcccacccgc gcctcatcga ggtcgccgac       540
     ctggtcgtcg agatgaccaa ggtcaagcac ccgatggacg cgggccagaa gggccagcgg       600
     gggatcgagt ggtga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page