(data stored in ACNUC7421 zone)

EMBL: CP002299.PE470

CP002299.PE470       Location/Qualifiers
FT   CDS_pept        575778..577226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0475"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="KEGG: gob:Gobs_0544 cobyrinic acid a,c-diamide
FT                   synthase; TIGRFAM: cobyrinic acid a,c-diamide synthase;
FT                   PFAM: CobB/CobQ domain protein glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78558"
FT                   /db_xref="GOA:E3J9Z6"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Z6"
FT                   /inference="protein motif:TFAM:TIGR00379"
FT                   /protein_id="ADP78558.1"
FT                   /translation="MRIPRVVLAAPASGAGKTSIATGLLAALRARGLAVSPHKVGPDYI
FT                   DPSYHALAAGRPGRNLDPWLVGEQRVAPLFLHGALHPRRADVAVVEGVMGLFDGHATRA
FT                   GFGSTAHVATLLAAPVVLVVDARSAGRSVAATVHGFRSFDPAVRIGGVVLNQVGTERHA
FT                   EILRAAMAEIGMPVLGVLGRRPDLVTPSRHLGLVPAAERAAPARDAVAELGAAVGSGLD
FT                   LDALLALAATAPDLPAEPWDARVAALEPVGSPVPAGPRPVVAVAGGPAFTFGYAETPEL
FT                   LAAAGAEVVGFDPTVDEALPAGTSGLIIGGGFPEVHAGALAANAALRSRVRAFAATGAP
FT                   VAAECAGLLYLSSALDGAPMCGVLGEVTAAMTPRLTLGYREAAAVTDSVLAARGTTVHG
FT                   HEFHRTVATPAAGGSTGGDARRGAAPAWRWRDASGVEVAEGFVRGAIHASYLHTHWAGV
FT                   PGAAHRFVAAARAAHQTEAFRAAG"
     gtgaggatcc cgcgggtcgt cctcgccgcg cccgccagcg gcgccggcaa gacgtccatc        60
     gccaccggtc tgctcgcggc cctgcgggcc agggggctcg ccgtctcgcc gcacaaggtc       120
     ggcccggact acatcgaccc gagctaccac gcgctcgcgg ccggccggcc ggggcgcaac       180
     ctcgacccct ggctcgtcgg cgaacagcgg gtcgccccgc tgttcctgca cggcgcgctg       240
     catcccaggc gggccgacgt cgccgtcgtc gagggcgtca tggggctgtt cgacgggcac       300
     gcgacccgcg ccggcttcgg ctcgacggcg cacgtggcca ccctgctggc ggcgcccgtc       360
     gtcctggtcg tcgacgcgcg gtcggccggg cggtcggtcg cggcgacggt gcacgggttc       420
     cggtcgttcg acccggccgt gcggatcggt ggcgtcgtgc tcaaccaggt cggcaccgag       480
     cggcacgccg agatcctgcg cgccgcgatg gccgagatcg gcatgccggt gctcggcgtg       540
     ctgggccggc gccccgacct ggtcaccccg tcgcgccacc tcggcctggt gccggccgcg       600
     gaacgcgccg cgccggccag ggacgccgtc gccgagctcg gcgcggcggt cggttccggc       660
     ctcgacctgg acgcgctgct cgcgctcgcc gcgacggccc ccgacctgcc cgccgagccg       720
     tgggacgcgc gggtcgccgc cctggagccc gtcgggtcgc cggtgcccgc cgggccgcgc       780
     ccggtggtcg cggtcgcggg cgggccggcc ttcacgttcg gctacgccga gacccccgag       840
     ctgctcgccg cagccggtgc cgaggtcgtc ggcttcgacc cgaccgtcga cgaggcgctg       900
     ccagccggca cgtcggggct gatcatcggc ggcgggttcc cggaggtgca cgcgggcgcg       960
     ctcgccgcga acgccgcgtt gcggtcccgg gtccgggcct tcgcggcgac cggcgccccc      1020
     gtcgccgcgg agtgcgccgg gctgctctac ctgagcagcg cgctcgacgg cgcgccgatg      1080
     tgcggggtgc tcggcgaggt gacggcggcg atgacgccgc gcctgacgct gggctaccgg      1140
     gaggcggccg cggtgaccga ctcggtgctc gcggcgcgcg gcacgaccgt gcacgggcac      1200
     gagttccacc gcacggtcgc gaccccggcg gcgggcggct cgaccggcgg cgacgcgcgt      1260
     cgcggtgcgg ccccggcgtg gcgctggcgg gacgcgagcg gtgtcgaggt cgccgagggc      1320
     ttcgtccgtg gcgcgatcca cgcgtcgtac ctgcacaccc actgggccgg ggtccccggc      1380
     gccgcgcacc gcttcgtcgc cgccgcccgc gcggcccacc agaccgaggc gttccgtgcc      1440
     gcgggctga                                                              1449
//

If you have problems or comments...

PBIL Back to PBIL home page