(data stored in ACNUC7421 zone)

EMBL: CP002299.PE472

CP002299.PE472       Location/Qualifiers
FT   CDS_pept        578187..579785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0477"
FT                   /product="cobyric acid synthase CobQ"
FT                   /note="KEGG: tcu:Tcur_1288 cobyric acid synthase CobQ;
FT                   TIGRFAM: cobyric acid synthase CobQ; PFAM: CobB/CobQ domain
FT                   protein glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78560"
FT                   /db_xref="GOA:E3J9Z8"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Z8"
FT                   /inference="protein motif:TFAM:TIGR00313"
FT                   /protein_id="ADP78560.1"
FT                   /translation="MSGALLVAGTTSDAGKSVLTAGICRWLARQGVRVAPFKAQNMSLN
FT                   SWVTADGAEIGRAQVMQAAAAGVEPEGAMNPVLLKPGAGHRSQVVLRGRPVAEAGALDY
FT                   RALKGRLFTEVLASLADLRSRFDVVICEGAGSPAEINLRADDIANMGLARAARLPTLVV
FT                   GDIDRGGVFAAMFGTLALLEPADQALVAGFVVNKFRGERALLEPGLGMLSGLTGRPVLG
FT                   VLPWRDGLGLDVEDSLGLPGPGETRGDLDGTLRVAAVRLPFLSNFTDLDALAAEPGVAV
FT                   RYVDRPEDLDAADLVVLPGTRSTVADLAWLRGRRLDGPLARRAATGRPVLGVCGGYQML
FT                   AETIVDEVESGAGRVDGLGLLPVTIRFAAAKTLGRPDGVAYGQPVRGYEIHHGVASVHG
FT                   GEPFLDGCRAGAVWGTTWHGAFENDGFRRAFLADVAARVGSPWQPRGEVSFAAVRERRL
FT                   DVLGDLVAEHLDTDALLRLLADGPPAGLPFIPPGAPTGAAGPALAGGAPAPPVTAGLPE
FT                   AGHLRSSVPDLGSRP"
     gtgagcggcg cgctgctcgt cgccgggacc acctcggacg cgggcaagtc cgtcctgacc        60
     gcgggcatct gccgctggct ggcccgccag ggcgtccggg tcgcgccgtt caaggcgcag       120
     aacatgtcgc tgaactcgtg ggtgaccgcc gacggcgccg agatcggccg cgcccaggtg       180
     atgcaggccg ccgcggccgg cgtcgagccg gagggcgcga tgaacccggt gctgctcaag       240
     ccgggggccg ggcaccgcag ccaggtcgtg ctgcgcggcc ggccggtggc cgaggcgggc       300
     gcgctcgact accgggccct gaagggccgg ctgttcaccg aggtgctcgc gagcctggcc       360
     gacctgcgct cccggttcga cgtcgtcatc tgcgagggcg ccggcagccc ggcggagatc       420
     aacctgcggg ccgacgacat cgcgaacatg ggcctggcca gggccgcgcg gctgccgacg       480
     ctggtcgtcg gcgacatcga ccgcggcggg gtgttcgccg ccatgttcgg gacgctggcc       540
     ctgctggagc cggccgacca ggcgctggtc gcggggttcg tcgtcaacaa gttccgcggc       600
     gagcgggccc tgctggagcc gggcctgggc atgctgtcgg gcctgaccgg ccgtcccgtg       660
     ctcggggtgc ttccctggcg agacgggctc ggcctggacg tggaggactc gctcggcctg       720
     ccggggccgg gcgagacgag gggcgacctc gacgggacgc tgcgggtggc ggcggtccgg       780
     ctgccgttcc tgagcaactt caccgacctg gacgcgctgg cggccgagcc cggcgtcgcg       840
     gtccggtacg tcgaccggcc ggaggacctc gacgccgccg acctcgtcgt gctgcccggc       900
     acccgctcga ccgtcgccga cctggcctgg ctgcgcgggc gtcggctcga cggcccgctc       960
     gcccgccggg ccgcgaccgg ccggccagtg ctcggcgtct gcggcggcta ccagatgctc      1020
     gccgagacga tcgtggacga ggtggagagc ggcgccggcc gcgtcgacgg cctcgggctg      1080
     ctgccggtga cgatccgctt cgccgcggcc aagacgctcg gccggccgga cggcgtcgcc      1140
     tacggccagc ccgtgcgtgg ctacgagatc caccacggcg tggcgtcggt gcacggcggc      1200
     gagccgttcc tcgacggctg ccgggccggc gcggtctggg gcaccacctg gcacggcgcc      1260
     ttcgagaacg acggcttccg ccgggcgttc ctcgccgacg tcgcggcccg ggtgggttca      1320
     ccgtggcagc cgcgcgggga ggtctcgttc gcggcggtcc gcgaacggcg cctcgacgtg      1380
     ctcggcgatc tggtcgcgga gcacctcgac accgacgcgc tgctgcggct gctcgccgac      1440
     ggcccaccgg ccggcctgcc gttcatcccg cccggagccc caacgggcgc cgccgggccg      1500
     gccctcgccg gtggggctcc agccccgcct gttacggccg ggctgccgga agccggccac      1560
     ctgcgtagtt ctgttccaga cctggggagc cgaccgtga                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page