(data stored in ACNUC7421 zone)

EMBL: CP002299.PE475

CP002299.PE475       Location/Qualifiers
FT   CDS_pept        584710..585360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0480"
FT                   /product="Precorrin-8X methylmutase"
FT                   /EC_number="5.4.99.61"
FT                   /note="KEGG: fal:FRAAL2332 precorrin-8X methylmutase; PFAM:
FT                   Precorrin-8X methylmutase CbiC/CobH"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78563"
FT                   /db_xref="GOA:E3JA01"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA01"
FT                   /inference="protein motif:PRIAM:5.4.1.2"
FT                   /protein_id="ADP78563.1"
FT                   /translation="MVTGSSQRRYDYERDGAAIYRQSFATIRAEAELADLAPDLEHVVV
FT                   RMIHACGMVDLPADVEASPGVVGIARTALRAGAPVLCDAQMVASGITRRRLPAANDIVC
FT                   ALGDPGVPELAARLGTTRSAAALELWADRLAGAVVAIGNAPTALFHLLELIGAGGPRPA
FT                   AVLGLPVGFVGAAESKQALADNPFGLPFLVVHGRRGGSAMTVAAVNAIASEAL"
     atggtgaccg gcagcagcca gcgccgctac gactacgagc gcgacggcgc ggcgatctac        60
     cggcagtcgt tcgcgacgat ccgcgccgag gcggagctgg ccgacctcgc gcccgacctg       120
     gagcacgtcg tcgtgcgcat gatccacgct tgcgggatgg tggacctgcc cgcggacgtc       180
     gaggcgagcc ccggcgtcgt cggcatcgcc cggacggcgc tgcgggccgg agcgccggtg       240
     ctgtgcgacg cgcagatggt ggccagcggg atcacccggc gccggctgcc cgccgccaac       300
     gacatcgtct gcgcgctcgg cgacccgggc gtcccggagc tggccgcccg gctcggcacc       360
     accaggtcgg ccgccgccct tgagctgtgg gccgaccggc tcgccggcgc cgtcgtcgcg       420
     atcgggaacg ccccgacggc actgttccac ctgctggagc tgatcggcgc gggtgggccg       480
     cgcccggccg ccgtcctggg gctgccggtc ggcttcgtgg gcgcggccga gtccaagcag       540
     gccctcgccg acaacccgtt cggcctgccc tttctcgtcg tgcacggccg gcggggcggc       600
     agcgcgatga cggtggccgc cgtcaacgcg atcgcctccg aggcgctgtg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page