(data stored in ACNUC7421 zone)

EMBL: CP002299.PE476

CP002299.PE476       Location/Qualifiers
FT   CDS_pept        585357..586910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0481"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /note="KEGG: nfa:nfa31520 putative precorrin 2
FT                   methyltransferase/precorrin 3B methyltransferase; TIGRFAM:
FT                   precorrin-3B C17-methyltransferase; precorrin-2
FT                   C20-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78564"
FT                   /db_xref="GOA:E3JA02"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA02"
FT                   /inference="protein motif:TFAM:TIGR01466"
FT                   /protein_id="ADP78564.1"
FT                   /translation="MTTQPPAAGTLYGVGVGPGDPELVTVKAVRLIGAAPVVAYHAARP
FT                   GRSLARASAAPYLRPGVVEEELVYPVTRGVTPHPGGYQGAIEEFYERSADRLADHLAAG
FT                   RDVVLLAEGDPTLYSSFTHMQRRLVPRFRCVIVPGVTSVSATAAAAGVALVTGDETLAV
FT                   LPATTRADRLRTLAGTADGLVLMKVRGDLGGVRQALADVGRLDDALLVSRASREGERVT
FT                   ALRDLGGSDQDVPYMSSVLVPGASAARPATPGQAVAGSVTVVGLGPAGAEWLTPEAACA
FT                   LAAADDVVGYETYLRRVPPRPGQRRHGTDNRVEAERAAFALDLARRGSRVAVVSSGDPG
FT                   VFAMASAVLETQADGGYQDVPVRVLPGVTAANAVAARVGAPLGHDYCVVSLSDQLKPWP
FT                   LVLRRLRAAAVADLVLALYNPGSKTRRAHMDEVRACLLEARGPDTPVVVGRAVGADGER
FT                   IEVIRLADLTADHVDMRTLLIIGSSRTRWDAATGAVFTPRHHDGLPGPVTADAAAGTHP
FT                   "
     gtgaccacgc agccacccgc cgccggcacg ctctacggcg tcggggtggg cccgggtgac        60
     cccgagctcg tgacggtgaa ggccgttcgg ctgatcggcg cggccccggt cgtggcgtac       120
     cacgcggcgc ggcccgggcg gtcgctggcc cgggcgagcg cggcgccgta cctgcggccc       180
     ggcgtcgtcg aggaggagct cgtctacccg gtgacccgcg gtgtcacgcc gcacccgggt       240
     ggctaccagg gtgcgatcga ggagttctac gagcggtccg ccgaccgcct ggccgaccat       300
     ctggccgccg ggcgggacgt cgtgctgctc gccgagggcg acccgacgct gtacagctcc       360
     ttcacccaca tgcagcgccg gctggtcccg cggttccggt gcgtgatcgt ccccggcgtg       420
     acgtcggtgt ccgcgaccgc cgccgcggcg ggcgtcgcgc tggtcaccgg ggacgagacg       480
     ctcgccgtgc tcccggcgac cacccgggcg gaccggctgc gcacgctggc cggcaccgcg       540
     gacgggctcg tgctgatgaa ggtgcgcggg gacctcggtg gcgtccgcca ggccctcgcg       600
     gacgtgggcc ggctggacga cgcgctgctc gtcagccggg ccagccggga gggcgagcgc       660
     gtcacggcgc tgcgcgacct gggaggctcg gaccaggacg tcccgtacat gtcgagcgtc       720
     ctcgtcccgg gcgcctccgc ggctcggccg gcgacgccag gtcaggccgt ggccggctcg       780
     gtcaccgtcg tcgggctggg gccagccggc gccgagtggc tcacccccga ggcggcctgt       840
     gccctcgcgg cggccgacga cgtcgtcggc tacgagacct acctgcggcg cgtcccgccc       900
     cggcccggcc agcgccggca cggcacggac aaccgggtgg aggcggagcg ggccgcgttc       960
     gcgctcgacc tggcccggcg ggggtcccgg gtcgccgtcg tgtcgtccgg ggacccgggc      1020
     gtgttcgcga tggcgtcggc ggtgctggag acccaggccg acggcggcta ccaggacgtg      1080
     ccggtgcgcg tgctgcccgg ggtcacggcg gcgaacgcgg tggcggcccg ggtcggcgcg      1140
     ccgctcggcc acgactactg cgtcgtgtcg ctgtcggacc agctcaagcc gtggccactg      1200
     gtgctgcgcc ggctgcgcgc cgccgccgtg gccgacctgg tgctcgccct ctacaacccg      1260
     ggctcgaaga cccgccgggc gcacatggac gaggtccgcg cctgcctgct ggaggcgcgg      1320
     ggcccggaca ctcccgtcgt cgtgggccgc gcggtgggcg ccgacggcga gcggatcgag      1380
     gtcatccggc tggccgacct gaccgccgac cacgtcgaca tgcgcacgct gctgatcatc      1440
     ggctcgtccc ggacccgctg ggacgccgcg acgggcgcgg tgttcacccc gcgccaccac      1500
     gacgggctgc ccggcccggt caccgccgac gccgcagcag gtacacatcc atga            1554
//

If you have problems or comments...

PBIL Back to PBIL home page