(data stored in ACNUC7421 zone)

EMBL: CP002299.PE477

CP002299.PE477       Location/Qualifiers
FT   CDS_pept        complement(586876..587652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0482"
FT                   /product="precorrin-6A synthase (deacetylating)"
FT                   /EC_number="2.1.1.152"
FT                   /note="TIGRFAM: precorrin-6A synthase (deacetylating);
FT                   KEGG: fal:FRAAL2802 precorrin 6A synthase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78565"
FT                   /db_xref="GOA:E3JA03"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012797"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA03"
FT                   /inference="protein motif:TFAM:TIGR02434"
FT                   /protein_id="ADP78565.1"
FT                   /translation="MADPAAPPRRSVLLIGMGVGDPASLTHEASAALAGVDVLFTIDKG
FT                   PAKADLNALRAEICARHARPGLRVVEVSEPDRDRAPDDYQAEVRRWHTARAEVWSRALL
FT                   TELGESDRGAFLVWGDPALYDSSLRILDDIRARGLVDVAVTVIPGISSVQVLAARHRVP
FT                   LNTVGGAVHVTTGRRLAAEAGGQDSVVVMLDGATAWLDLDASRWDIYWGAYLGGADEIT
FT                   IAGPLAEVGAEIATAKQTARARKGWIMDVYLLRRRR"
     atggcagacc cggccgcgcc gcctcgccgg tccgtgctgc tgatcggcat gggggtcggc        60
     gatcccgcct cgctcaccca tgaggccagc gccgcgttgg ccggcgtcga cgtgctgttc       120
     acgatcgaca aggggcccgc gaaagccgac ctgaacgcgc tgcgggccga gatctgcgcc       180
     cggcacgcgc ggccggggct gcgggtcgtc gaggtcagcg agccggaccg ggaccgggcg       240
     cccgacgact accaggccga ggtgcgccgc tggcacaccg cccgcgccga ggtctggtcc       300
     cgggccctgc tgacggagct gggcgagtca gaccggggcg cgttcctggt ctggggtgac       360
     ccggcgctgt acgacagctc gctgcgcatc ctcgacgaca tccgggcacg cggcctggtc       420
     gacgtcgcgg tgaccgtcat ccccgggatc tccagcgtgc aggtgctggc cgcccggcac       480
     cgggtcccgc tcaacacggt cggcggggcg gtgcacgtca ccaccgggcg gcgcctggcc       540
     gccgaggcgg gcggccagga ctcggtggtc gtcatgctcg acggcgccac ggcctggctg       600
     gacctcgacg cgagccggtg ggacatctac tggggtgcct acctgggcgg cgccgacgag       660
     atcacgatcg ccggcccgct cgccgaggtc ggcgccgaga tcgcgacggc caagcagacg       720
     gcccgcgccc gcaagggctg gatcatggat gtgtacctgc tgcggcgtcg gcggtga          777
//

If you have problems or comments...

PBIL Back to PBIL home page