(data stored in ACNUC7421 zone)

EMBL: CP002299.PE478

CP002299.PE478       Location/Qualifiers
FT   CDS_pept        587940..588524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0483"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="KEGG: scb:SCAB_66441 putative acetyltransferase;
FT                   manually curated; PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78566"
FT                   /db_xref="GOA:E3JA04"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA04"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADP78566.1"
FT                   /translation="MSLRHESAHDRESVRGVVTRAFGGEHGEVVADLVDDLRATISPGT
FT                   GLSLVAEDDGEIVGHAMFTRSLLDAPRRLVEVQVLSPLAVLPEYQKRGLGSALVRHGLE
FT                   ILAESSSPLVFLEGDPSYYHRFGFVPGGGLNFRKPSLRIPDAGFQVVTLPAYQPWMTGT
FT                   LVYSELFWRHDAVGLRQNEAEKVAPPVPGSA"
     gtgagtcttc gccatgaatc ggcccatgac cgggaatccg tgcgaggcgt tgtcacgcgg        60
     gcgttcggcg gtgagcacgg ggaggtcgtc gcggatctcg tggatgacct tcgcgccacc       120
     atctcgcccg gcactggcct ttcgctcgtt gccgaggatg acggcgagat cgtcggccac       180
     gcgatgttca cccgcagcct cctcgacgcg ccgcggcggc tggtcgaggt ccaggtcctc       240
     agcccgttgg cggtcctgcc cgagtaccag aagcgcgggc tcggctcggc ccttgttcgc       300
     catggcctgg aaatcctcgc cgagtcctcg tcgccactcg tcttcctcga aggcgacccg       360
     agctactacc accgcttcgg ctttgtgccc ggcgggggcc tgaacttcag aaagccgtcg       420
     ttgcgcattc ccgacgcggg cttccaggtt gtcacgctcc cggcctacca gccgtggatg       480
     acgggaaccc tcgtctactc ggaactgttc tggcggcacg acgcggtcgg ccttcgccag       540
     aacgaggccg agaaagtcgc cccgcccgtt ccggggtccg cgtga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page