(data stored in ACNUC7421 zone)

EMBL: CP002299.PE480

CP002299.PE480       Location/Qualifiers
FT   CDS_pept        complement(589693..590928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mva:Mvan_2552 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78568"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA06"
FT                   /inference="similar to AA sequence:KEGG:Mvan_2552"
FT                   /protein_id="ADP78568.1"
FT                   /translation="MTEPQVEPAPDPASVSTEDELRAAVLALLGDSYDRAVERRTGLSK
FT                   TTVNDVRNERRRLTAKTLTLIVEAYDPHRRDVWLAAWRRVRTRSERAGASLAADDDAHP
FT                   AGPGDGLAGTDTDADPIAAAEANLAGVTGGSPLLDGSRGGAGMGQPAGPGRSGSGPWRT
FT                   VSLAAGIALVASAGAALITYFAVRGDAAPPSAPVATNAAPAGGPGPVLPGQAPPLGPGG
FT                   PGAAWPVGGIGPPRIDQSPAARGPAPVARGCYSLPLQTRADVVAQSGADAAGLRVTELR
FT                   YTYYPAWHPSLAFGGRLSGPVPRSSRLVFAAWADPSTTDSTRDHNRGNGRFYPGDDLPT
FT                   TDENCFTVPPYNLSYGGYPGITTRLYAMLVDATDVKPFLRAAGQSAGLTDTDLARLGIR
FT                   ILGYAVVPSKPE"
     atgacggagc cgcaggtgga gccggcgcca gaccccgcgt cggtgtcgac cgaggacgag        60
     ctgcgcgccg ccgtgctcgc cctgctgggc gactcctacg accgggccgt cgagcggcgg       120
     accgggctgt ccaagaccac cgtcaacgac gtccgcaacg agcgcagacg gctgaccgcg       180
     aagaccctga ccctgatcgt cgaggcgtac gacccgcatc gccgggacgt ctggctggcg       240
     gcctggcggc gggtccggac ccgctccgag cgggccggcg cctcgctggc cgccgacgac       300
     gacgcccacc cggccggacc cggtgacggt ctcgcgggaa ccgacaccga cgcggacccg       360
     atcgctgcgg ccgaggcgaa cctggctggg gtcaccggcg gttccccgct gctcgacggt       420
     tcccggggcg gcgccgggat gggccagccg gcggggccgg gacggtccgg ttccggaccc       480
     tggcggacgg tgtccctggc cgccggcatc gccctcgtcg cgagcgccgg cgccgcgctg       540
     atcacctact tcgcggtgcg cggggacgcg gcgcccccgt ccgctccggt cgcgacgaac       600
     gccgccccgg cggggggccc tggacccgtt cttccaggcc aggccccgcc gctggggccc       660
     ggcggtcccg gcgcggcctg gccggtcggc gggatcggcc cgccccgcat cgaccagagc       720
     ccggcggcgc gcggcccggc ccccgtcgcc aggggctgct actccctgcc gctccagacc       780
     agggccgatg tggtggccca gtcgggggcc gacgccgccg gcctgcgcgt caccgagctg       840
     cgctacacct actacccggc ctggcatccg tcgctggcct tcggaggccg gctcagcgga       900
     ccggtcccgc gcagttcgcg gctggtcttc gccgcgtggg ccgatcccag cacgaccgac       960
     tccacaaggg accacaaccg gggtaacggc cgcttctacc ccggcgacga cctgccgacg      1020
     accgatgaga actgcttcac ggttccgccc tacaacctga gctacggcgg atacccgggg      1080
     atcacgacgc gcctctacgc gatgctcgtc gacgccacgg acgtgaagcc gttcctgcgc      1140
     gccgccggcc agtccgccgg tctgaccgac acggacctcg cgcgcctggg catccggatt      1200
     ctcggctacg ccgtcgtgcc gtccaagccc gagtaa                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page