(data stored in ACNUC7421 zone)

EMBL: CP002299.PE484

CP002299.PE484       Location/Qualifiers
FT   CDS_pept        complement(595658..596332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0489"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_1029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78572"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040632"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA10"
FT                   /inference="similar to AA sequence:KEGG:Sros_1029"
FT                   /protein_id="ADP78572.1"
FT                   /translation="MLDIIGVGFGRTGTLSLKSALEQLGFGPCHHGDEVIAHRETAVDW
FT                   IQAADGRPVDWDAIYDGYRSTVDWPGARFWRELTAHFPEAKVILTFRDPEQWYESMCNT
FT                   VFRAISNVPAQVPPEVLPLITMIRRVTMDGVFGGEVPDRETALRIFAEHIEAVRAQIPG
FT                   DRLLIFDVAEGWGPLCAFLDVPVPATPFPRANDQDFFTTTHQTRLATAALAAAAGDEAS
FT                   KS"
     atgctcgaca tcataggcgt cggattcggg cggaccggaa cactgtcact caaatccgcg        60
     ctcgaacagc tcggcttcgg cccctgtcac cacggcgacg aggtgatcgc gcaccgggag       120
     accgcggtcg actggatcca ggcggcggac ggaaggccgg tcgactggga tgccatctat       180
     gacggctacc ggtcgaccgt cgactggccc ggtgcccgtt tctggcggga gctcacggcg       240
     cacttcccgg aagccaaggt gattctcacc ttccgcgatc cggagcagtg gtacgagagc       300
     atgtgcaaca cggtctttcg ggcaatctcg aatgtgccgg cgcaggttcc gccggaagtc       360
     cttcctctga tcacaatgat cagaagggtg acgatggacg gcgtgttcgg cggcgaggtc       420
     ccggaccggg agaccgccct gcggatcttc gccgagcaca tcgaggccgt ccgcgcccag       480
     atccccggcg accggctgct gatcttcgac gtggccgagg gctggggccc gctctgcgcg       540
     ttcctcgacg tcccggtccc ggcgaccccg ttcccccgcg ccaacgacca ggacttcttc       600
     accaccacgc accagaccag gctcgccacg gcagcgctcg cggccgccgc cggcgacgag       660
     gcatcgaaga gttag                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page