(data stored in ACNUC7421 zone)

EMBL: CP002299.PE49

CP002299.PE49        Location/Qualifiers
FT   CDS_pept        55780..57180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0049"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   gbm:Gbem_1624 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78137"
FT                   /db_xref="GOA:E3J3D5"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3D5"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADP78137.1"
FT                   /translation="MRVTIVSQYFWPEQFRVNDLAVGLRERGHHVTVLTGQPSYPRRDS
FT                   FPRRRRPSREWYEGVEVVRVRLASRGNGEPWRLALNYLSFAASASVLGVPRLPPSDVVL
FT                   VYQMSPVTTALPAFLLRRIRGAPVVVWVQDLWPRTLRATGTIRSERVLGVIDRVVRAGY
FT                   RRCARVLGQSEDFLPLLRAAGVPAERLDYLPNWAEGQYRPEPPDEEVRRAAGIPDGFVA
FT                   MFAGNLGVAQALETLVGAAELTRDRPELADMHWVVLGDGQRGAWLADEVRRRGLTGRVH
FT                   LLGQAPPQQLPALFAHADVLVTALRRDSVWALTVPSRVQSFLACGRPVVSSADGTTGRV
FT                   VAAAGGIAVPAEDPAALADAVAQVHALGPTERAAMGVAAREYYVTHYERAALLDRVERH
FT                   LRDAAGLSAAPVRVPTPAPAPTRPTAHGGPAVPAQPSVAAGAAGSGGPAKAKPAGPEVP
FT                   AADVTETA"
     atgcgcgtca cgatcgtcag ccagtacttc tggccggagc agttccgcgt caacgacctg        60
     gccgtgggcc tgcgcgagcg tggccatcac gtcacggtgc tgaccggcca gccgagctac       120
     ccgcgccggg actccttccc gcggcgacga cgaccaagcc gggaatggta cgagggcgtc       180
     gaggtcgtgc gggtgcgcct cgcctcccgc ggcaacggcg agccctggcg gctggccctg       240
     aactacctga gcttcgcggc cagcgccagc gtcctggggg tgccgcggct gccaccgtcg       300
     gacgtggtgc tcgtctacca gatgtcaccg gtgacgacgg cgctgcccgc cttcctgctg       360
     cggcggatcc gcggtgcccc ggtggtggtg tgggtccagg acctgtggcc gcggaccttg       420
     cgggcgaccg gcacgatccg ctccgaacgg gtgctgggcg tcatcgaccg ggtggtgcgc       480
     gccggctatc ggcggtgcgc ccgggtgctc gggcagtcgg aggacttcct gccgctgctg       540
     cgggcggccg gcgtgcccgc ggaacggctg gactacctgc cgaactgggc cgagggccag       600
     taccgccccg agccgccgga cgaggaggtc cgccgcgccg ccggtatccc ggacggcttc       660
     gtcgcgatgt tcgccggcaa cctcggggtc gcgcaggcgc tggagacgct ggtcggcgcg       720
     gccgagctca cccgggaccg gccggagctg gccgacatgc actgggttgt cctgggcgac       780
     ggccagcgcg gcgcgtggct ggcggacgag gtccgccgcc gcggcctcac cggccgggtc       840
     cacctgctcg gccaggcccc gccgcagcag ctgccggcgc tgttcgcgca cgcggacgtg       900
     ctggtcacgg ccctgcgcag ggactcggtg tgggcgctca ccgtgccgag ccgggtgcag       960
     tcgttccttg cctgcggccg gccggtcgtc tcgtcggccg acggcaccac cggccgggtc      1020
     gtggccgcgg ccggcgggat cgcggtgccg gccgaggacc cggcggcgct cgccgacgcg      1080
     gtcgcccagg tccacgcgct cgggccgacc gaacgcgccg ccatgggcgt cgcggcgagg      1140
     gagtactacg tgacgcacta cgagcgggcc gcgctgctcg accgggtcga gcggcatctg      1200
     cgcgacgcgg ccgggctgtc ggcggcaccc gtccgggtgc cgacgcccgc gccggctcct      1260
     acgcggccga ccgcccatgg cggcccggcg gttcccgcgc agccctcggt ggcggccggc      1320
     gcggcgggct cgggtggccc ggccaaggcc aagccggctg ggcctgaggt gcccgccgcc      1380
     gacgtgacgg agacggcctg a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page