(data stored in ACNUC7421 zone)

EMBL: CP002299.PE491

CP002299.PE491       Location/Qualifiers
FT   CDS_pept        604283..605179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0496"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: cai:Caci_7474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78579"
FT                   /db_xref="GOA:E3JA17"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA17"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADP78579.1"
FT                   /translation="MATQHPPLPAATRRRRFRLGIALLVSCVALVAWIADLSVSLPMHY
FT                   ETEGWRLAWTGYDVAELGALATTAYCALRDRWALIPASVVTATLLLCDAWFDMALSSGT
FT                   DDFLISLATALLVEIPTATVLLLVAWRLTRRLRDKATDAVQPGAATLDVALRDAAFGAE
FT                   LRAILDGPSIATLAMIGTDGEPHSRVVGLHREGDALLLSIVAPRQPSSDLAKDAQVSVS
FT                   VFDLTNPRTAVEIRGIARLLADGERPGPVALAREAEPTPTPLARTSEPPELLDPADPSG
FT                   IRLVARLFPTAITRLAS"
     atggccactc agcacccgcc gctgccggcg gccacccgcc gacgtcgctt tcgcctcggg        60
     atcgcgctgc tggtcagctg cgtcgctctc gtcgcctgga tcgccgactt gtccgtcagc       120
     ctgccgatgc actacgagac cgagggctgg cggctggcct ggaccggtta cgacgtcgcg       180
     gagctcggcg cgctcgcgac gacggcctac tgcgcgctgc gagaccgctg ggccctgatc       240
     cccgcctcgg tggtcactgc cactcttctt ctttgtgacg cctggttcga catggcgctg       300
     tcgtccggga ccgatgactt cttgatcagc ctggcgaccg cgctgctcgt cgagatccca       360
     acggcgaccg tgctcctcct ggtcgcctgg cgcctcaccc ggcggctgcg ggacaaggcg       420
     accgatgccg tccaaccggg cgcggcgacc ctggacgtcg cgctgcgcga cgcggcgttc       480
     ggggccgagt tgcgcgcgat cctggacggg ccgagcatcg ccacgctcgc catgatcggc       540
     accgatggcg agccccattc gcgcgtcgtg gggctgcacc gcgaaggcga cgcgctgctg       600
     ctgtcgatcg tggccccgcg gcagccgtcc agtgatctgg cgaaggacgc ccaggtgagc       660
     gtctcggtct tcgatctgac caacccgcgc accgccgtcg agattcgagg gatcgcacgg       720
     ctcctcgcgg acggcgagcg acccgggccc gtggcactcg cgcgcgaagc cgagcccacg       780
     ccgacgccgc tcgcgcgcac gtcggaacct ccggaactgc tggatccggc ggacccctcc       840
     gggattcgtc tcgtcgccag actcttcccc accgccatca cccgcctggc gtcctga          897
//

If you have problems or comments...

PBIL Back to PBIL home page