(data stored in ACNUC7421 zone)

EMBL: CP002299.PE495

CP002299.PE495       Location/Qualifiers
FT   CDS_pept        complement(610898..611947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0500"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_2941 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78583"
FT                   /db_xref="InterPro:IPR021710"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA21"
FT                   /inference="similar to AA sequence:KEGG:SAV_2941"
FT                   /protein_id="ADP78583.1"
FT                   /translation="MSKRPNPTRADLLALLGAQPETSVAAICRSYLSRRRELLASDPDH
FT                   RRPEVARLDDAFTRLRAATDLESRLDDYPCAEVKIGVEDTTVVVRSAPAGTASGEFPFP
FT                   GVERVHVLTAFNPRSRRLRPHENANRQRALAGRVATTGLPSWPAVGGGRQAQTSIAVAG
FT                   LTRARARALGAEFEQDAVVEWTPTALSVVPCDELVAPREFGWRSSRLTKPLPNPAAAAR
FT                   RAEAARAAHAVHAATDTQAADTDRLPATDEARAAADGSGPVSEAHEILVADAVRALAAE
FT                   ESETAAIARARELTAATPTEDSGATPNGTTAGGPTAGGPPAPRKADPAAGGATPDPHDL
FT                   PASHGGNGE"
     gtgtccaagc gcccgaaccc cacccgcgct gacctgctgg ccctgctcgg ggcccagccg        60
     gagacctccg tcgcggccat ctgccgttcc tacctttccc ggcgtcggga gctgctggcc       120
     tccgacccgg accaccgccg tcccgaggtg gcccggctgg acgacgcctt cacccggctg       180
     cgcgccgcca cggatctcga aagccggctc gacgactacc cgtgcgccga ggtcaagatc       240
     ggcgtcgagg acaccaccgt ggtcgtgcgc tcggcgcccg ccggcaccgc cagcggggag       300
     ttcccgttcc ccggcgtgga gcgggtgcac gtactcaccg cgttcaaccc gcgctcccgc       360
     cggctgcgcc cgcacgagaa cgccaaccgg cagcgcgcgc tcgcgggccg ggtcgcgacg       420
     accggcctgc cctcgtggcc cgcggtcggc ggcggccggc aggcgcagac gagcatcgcc       480
     gtcgccggcc tgaccagggc acgggcccgc gcgctcggcg ccgagttcga gcaggacgcc       540
     gtcgtcgagt ggactccgac ggcactgtcc gtggtgccgt gcgacgaact ggtcgcgccg       600
     cgcgagttcg gctggcgtag ctcgcgtctg accaagccgc tgcccaaccc ggcggccgcg       660
     gcccgccgcg ccgaggcggc cagggcggcg cacgccgtgc acgcggcgac cgacacccag       720
     gcggcggaca ccgaccggct gccggcgacc gacgaggcgc gcgccgcggc cgacggctcc       780
     ggtccggtca gcgaggcgca cgagatcctc gtggccgacg cggtccgggc actcgcggcc       840
     gaggagtcgg agaccgcggc gatcgcgcgg gcgcgggagc tcaccgccgc gacgccgacg       900
     gaggacagcg gcgcgacccc gaacggcacg acggcgggtg gtccgacggc cggtggtccg       960
     cctgcgccgc gcaaggccga cccggcggcc gggggcgcca cgccggaccc gcacgatctt      1020
     cccgcctccc acggcggcaa cggtgagtga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page