(data stored in ACNUC7421 zone)

EMBL: CP002299.PE496

CP002299.PE496       Location/Qualifiers
FT   CDS_pept        complement(612339..615752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0501"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="KEGG: fal:FRAAL3851 putative serine/threonine
FT                   protein kinase; PFAM: Serine/threonine-protein kinase-like
FT                   domain; PASTA domain containing protein; SMART:
FT                   serine/threonine protein kinase; Tyrosine-protein kinase,
FT                   catalytic domain; PASTA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78584"
FT                   /db_xref="GOA:E3JA22"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA22"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADP78584.1"
FT                   /translation="MAGGGLPASRCQGLSDVSGIRQKTTKLSPGASSQWDARPSDISLV
FT                   NGGDVDSRGGASRALARPPARATQLPGSPLRPSDPRELDGYQLLRRLGEGGMGTVYLGR
FT                   SPTGRRVAVKIVRAELADDPEYRARFRREAEVARRVARYCTAEVLDAVDPPDGAPYLVT
FT                   EFVDGPPLSQTVSRRGPLGSADVERVAVSVASALTVIHAAGLVHRDLKPSNVLLSQFGP
FT                   RVIDFGVAWAPDSVAVTRDLVVGTPAFMAPEQARGQRVTSAADIFSWGGLIIFAATGRR
FT                   PFGGGAVPAVLYRIVNSDPDLDGLDEGLTEVVRDAMRRDPAERPTAAEIVNRLQALSTI
FT                   RATTPIWVTPPASEPVAAESGALAQAGTAANGAEPNGAAPAADSAGTDAAGSDAASSGA
FT                   AEPVTPADGSGGGLGEDAPAVNAGAAGESAASAESEADAGSSAGAEAAATGVPAADGTD
FT                   AASSDTSDAGAGTPAAGVVSAAAAQDGTDPAANADQAGTGAGSAARTGTAAGSPGADAA
FT                   EDGSQGDSSVGDSSLGDGTLGDGASAADAGAHVSATADDSQGPADDAVSEPGADMAGDD
FT                   EDPPTVGSGPIPVAGLNDDFTFGDLSVWGDDGTELTVGYLARLGSVGEELDDSDDHGFR
FT                   DLDYTDFDSASGLDSDGLEYADFDDGSGGVNRISQRTVTLRGDSPRGPGRTLETLSLNG
FT                   LDDSGRSTWPPPRRRGPLAALARWFPGFAPGGRIPWTTVISAFSVIVALAAVGVAAAAA
FT                   VDSSGRSANATLAAQLTIPNNLVGLSVKEAEARLHAAGFAHLQFEMTPDLKPKGTVLSV
FT                   QPGEGIEIEASDTVTLVVSAGLDSVKIPQVVGLTDSAARSNLQDAGLTVVVRSISGPAS
FT                   VSPGHVAAIFPAAGVEVPPGSSVTILVVVPAGTKSLASVPNVIGMTTNDAQDALHKAGF
FT                   TDIAISSVAASEPAGTVTASDPAANTTTAKNATVTLTVSTGPGQTAVPDVAGRTQADAE
FT                   AALAQAGLVATVRQDPGPSTITAGLVETVDPAPGSKVPVHAEVTITVVSTQVAMPDARG
FT                   RQRADAERLLTSYGLTVTVTQQSSSAAPGTVLTQSTTPGAMIGRGSNVTLVVAKAADSP
FT                   TSPPTSPSPPPTSPPPTGPTSPSPPASATA"
     gtggccggcg ggggcctccc ggcgagtcgg tgtcaggggt tgtcggacgt gtcaggtata        60
     cgacagaaga caaccaaact gtcgcctggg gcgtcctcac agtgggacgc gcggccgtcc       120
     gacatttctc tggtcaacgg gggggacgtg gactcacgcg gaggcgcgtc gcgtgcgttg       180
     gcgcgcccac cggcgcgggc gacgcagctg ccgggcagcc cgttgcgccc gtcggacccg       240
     cgcgagctcg acggctacca gctgctgcgc cgcctcggcg agggcggcat gggcaccgtc       300
     tacctgggcc gatccccgac cggccgtcgg gtcgccgtca agatcgtgcg cgccgagctg       360
     gccgacgacc ccgagtaccg ggcccggttc cggcgtgagg ccgaggtcgc ccgccgggtc       420
     gcccgctact gcaccgccga ggtgctcgac gccgtcgatc ccccggacgg cgcgccctac       480
     ctggtgacgg agttcgtcga cgggccgccg ctgtcccaga cggtgtcgcg gcgggggccg       540
     ctcggatcgg ccgacgtgga gcgggtcgcc gtcagcgtcg cctcggcgct caccgtgatc       600
     cacgcggccg gcctggtgca ccgcgacctc aagccgtcga acgtcctgct ctcgcagttc       660
     ggcccccggg tgatcgactt cggtgtggcg tgggcgccgg acagcgtcgc ggtgacccgc       720
     gacctggtcg tcggcactcc cgcgttcatg gccccggagc aggctcgcgg ccagcgggtg       780
     acgtccgccg ccgacatctt ctcctggggc ggcctgatca tcttcgcggc gaccgggcgg       840
     cgcccgttcg gcggcggagc ggtgccggcc gtgctgtacc ggatcgtcaa ctcggacccg       900
     gacctcgacg ggctcgacga ggggctgacc gaggtcgtgc gggacgccat gcggcgggac       960
     ccggccgagc gcccgaccgc ggcggagatc gtcaaccggc tccaggcact gagcacgatc      1020
     cgggccacga cgcctatctg ggtcactccc ccggccagcg agccagtggc cgccgagagc      1080
     ggcgcgctcg cgcaggcggg caccgccgcg aacggtgccg aaccgaacgg tgccgcgccg      1140
     gccgccgatt cggcgggcac ggacgcggcc ggctccgacg cggcgagcag cggcgccgcc      1200
     gagcccgtga cgcccgccga cgggtccggt ggcggcctcg gggaggacgc cccggccgtg      1260
     aacgccgggg ccgcaggtga gtcggcagcc agtgcggagt cggaggccga cgccgggagc      1320
     tcggccggcg cggaggcggc cgctaccggg gttcctgcgg ccgacggcac ggacgcggcc      1380
     agctccgaca cgtctgacgc cggcgcgggc accccggccg cgggcgtggt gtcggccgcc      1440
     gcggcccagg acggcacaga tccggccgcc aacgcggacc aggccggcac cggcgcgggc      1500
     agtgccgctc ggaccggcac ggcagccggg tcgccggggg ccgacgcggc cgaggacggc      1560
     tcgcagggcg acagctcggt cggggacagc tcgctgggcg acggcacgct cggtgacggt      1620
     gccagcgcgg ccgacgccgg ggcacacgtc tccgccacgg ccgacgactc tcaggggccc      1680
     gccgacgacg ccgtgagcga gcccggcgcg gacatggccg gcgacgacga ggacccgccg      1740
     acggtcggca gcggtccgat acccgtggcc ggcctgaacg acgacttcac cttcggtgac      1800
     ctgagtgtct ggggtgacga cggcaccgag ctcaccgtcg gctacctggc ccgactcggc      1860
     tccgtcggcg aggagctgga cgactccgac gaccacggct tccgcgacct ggactacacc      1920
     gatttcgact cggcctccgg tctggactcc gacggcctgg agtacgccga cttcgacgac      1980
     ggctccggcg gcgtcaaccg gatcagccag cggacggtca cgctacgcgg tgactcgcca      2040
     cgcggcccgg gacgcactct ggagaccctg tcgctgaacg gcctcgacga ctcaggccgg      2100
     tcgacctggc cgccgccccg caggcgcggc ccgctggcgg cgctcgcccg gtggttcccg      2160
     ggcttcgcgc ccggcggccg gatcccgtgg acaaccgtga tcagcgcctt cagcgtgatc      2220
     gtggcactgg cggccgtcgg ggtggcggcc gcggccgcgg tggacagttc gggccggtcc      2280
     gccaatgcca cgctggccgc gcagctgacc atcccgaaca acctggtggg cctctccgtc      2340
     aaggaggctg aggcccggct gcacgcggcc ggcttcgctc acctgcagtt cgagatgacg      2400
     cccgacctca agccgaaggg caccgtcctc agcgtccagc cgggcgaggg catcgagatc      2460
     gaggcgagcg acacggtgac gctggtcgtc tcggcgggcc tggattccgt caagatcccc      2520
     caggtcgtcg ggctcaccga cagcgccgcg cggtccaacc tgcaggacgc gggcctgacc      2580
     gtcgtcgtgc ggtcgatcag cgggccggcg agcgtcagtc ccggccacgt ggcggcgatc      2640
     ttccccgctg ctggggtgga ggttccgcct gggtccagcg tcacgatcct ggtcgtcgtg      2700
     ccggccggca cgaagtcgct ggccagcgtg ccgaacgtga tcgggatgac gacgaacgac      2760
     gcgcaggacg ccctgcacaa ggccggtttc accgacatcg cgatctcctc cgtcgccgcc      2820
     tcggaaccgg ccggcacggt caccgccagc gacccggccg ccaacacgac gacggccaag      2880
     aacgcgaccg tgacgctgac ggtgtccacc ggcccgggcc agaccgcggt tcccgacgtc      2940
     gccggccgga cccaggccga cgccgaggcc gccctcgcgc aggccgggct ggtcgccacc      3000
     gtcaggcagg acccggggcc gtcgaccatc accgctgggc tggtggagac cgtcgatccc      3060
     gcgcccggct cgaaggtgcc ggtgcacgcc gaggtgacga tcaccgtggt cagcactcag      3120
     gtcgcgatgc cggacgcgcg gggccgccag cgcgccgacg ccgagcggct gctgacctcc      3180
     tacggcctga ccgtcacggt gacgcagcag tcgagcagcg ccgcgcccgg caccgtgctg      3240
     acgcagtcga ccaccccggg cgccatgatc ggccgcggga gcaacgtcac gctcgtggta      3300
     gcgaaggccg ccgactcgcc gacctcgccg ccgacctcgc cgtccccacc gccgacctcg      3360
     cctcccccga ccgggccgac ctcgccgtct ccgcccgcct cggcgacggc ctga            3414
//

If you have problems or comments...

PBIL Back to PBIL home page