(data stored in ACNUC7421 zone)

EMBL: CP002299.PE497

CP002299.PE497       Location/Qualifiers
FT   CDS_pept        complement(615812..616204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0502"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: stp:Strop_2027
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78585"
FT                   /db_xref="GOA:E3JA23"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA23"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADP78585.1"
FT                   /translation="MKLAQVMVLVDEYDPAIVFFTEVLGFELVEDSPATTNDGRPKRWV
FT                   VVRPPGAETSILLARADGPAQSAAVGHQAAGRVGFFLHVDDFEASYQRMLAANVTFLGE
FT                   PRDEPYGRVVVFLDLAGNRWDMIQPA"
     gtgaagctcg cccaggtgat ggtgctcgtc gacgagtacg accccgcgat cgtcttcttc        60
     accgaggtgc tcggcttcga gctggtcgag gactcgccgg cgacgaccaa cgacgggcgg       120
     cccaagcgct gggtggtggt ccgcccgcca ggcgccgaga cctcgatcct gctcgcgcgt       180
     gccgacgggc cggcgcagtc cgctgccgtg ggtcaccagg cggccggtcg cgtcggcttc       240
     ttcctgcacg tcgacgactt cgaggcgagc taccagcgga tgctggccgc gaacgtcacc       300
     ttcctcggtg agccgcgcga cgagccgtac ggccgggtcg tggtcttcct cgacctcgcc       360
     ggcaaccgct gggacatgat ccaaccggcc tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page