(data stored in ACNUC7421 zone)

EMBL: CP002299.PE499

CP002299.PE499       Location/Qualifiers
FT   CDS_pept        complement(617140..620079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0504"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78587"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA25"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6441"
FT                   /protein_id="ADP78587.1"
FT                   /translation="MTRTPRSGPPAPSSAGPVGTPGSSGLAGLGPLAGPAAAPGDEHAE
FT                   QNGGPRDEPAPSGRARRLTSIAAALALVAVGGAAALGRGSHSVALTLSDGGGWLASERL
FT                   GLLFHVNGPSGQADAAVTLPGAAGHPLTVLTGFARPAAAAPTDAAPSGPAGTRPSASAT
FT                   TPTPSAAAARAPGAAATGAAADLGAGWPSDQAEAVIVVDDLAGTVWLVDPSLLTISASV
FT                   ALPPGAVVLAAAGDAYAVDAATGRVIRLDPRTLAQLGAPITFPAGLGTAAQTPDGTLWV
FT                   PVASAGTVVPVRAGTPGTPVPVAPAGDRLDVTTVAGSAVVVDQTAGTVVRLAMDHADAA
FT                   IRLPDAPATSGAAARLLLPTSTDGQVLALAQPANGELLLADLATGRVSTTTLPAVGAAD
FT                   VDVSALAAATGTGTGAGHQVGAPVSHDGQVYVPDSNAGVVWDFDPKTARFAAPVPVAPV
FT                   GTPSRISLDVQSGQLWINDETGPTVVLVNGASRRTLLKFGAALPGGLRTNTPRPLPPGP
FT                   TPTASQSSSQGGGTGAGGTGSGGRPGLIWPGWTPSSRPGTRGDGGGRADGTGRGTGGRG
FT                   DDRTGAGNGRGGGQPGGQTGEPTGNRPTGPGQPEPPASNTAAPPQPEPTAGQQTPGEPT
FT                   GSGGPGGGQTGGTDQAGAGGGVGTGGSQAASGAGVDGQSPNQAGDGAPGPADPPAAQPT
FT                   TAPAPTGPPSGSAGAPGHPTGPATPTPSPGHAPTPPDQGSPRPPGFWLLTADGTVLARG
FT                   TAQAVASTGADPGAVAIAPTATGRGYWLVDATGAGRPVGDAPAVPAAAGTGTVVAAAAG
FT                   PTGGGYWTVTATGTVVPHGTLTGYGSLLSAPGAPVVGIAATPTGGGYWLLDAAGGVYPF
FT                   GDAEAIAPGAQPTGPATGPQRSVGIAASPTGAGYWTVTAAGLVSAHGGAGGYGSASGSS
FT                   TVVGIAATPSGRGYWLLDTAGGAQAFGDAITTGATAAAGTRVIAVAAAP"
     gtgacccgca caccgcgaag cggaccgccc gcgcccagtt cggccggccc cgtcggaacg        60
     cccggctcca gcgggctggc gggcctcggc ccgctcgcgg gtccggccgc ggcgcccggc       120
     gacgagcacg ccgaacagaa tggcgggccg cgggacgagc cggcaccgtc gggccgggcc       180
     cgccggctga cgtcgatcgc cgcggcgctc gcgcttgtcg cggtcggtgg cgcggcggcg       240
     ctcggccgcg gctcccactc ggtggcgttg acgctgtcgg acggcggcgg ctggctcgcg       300
     agcgagcggc tcggtctgct gttccacgtc aacgggccgt ccgggcaggc cgacgcggcg       360
     gtgacgctcc ccggcgcggc cgggcacccg ctgaccgtgc tgaccggctt cgcccggccg       420
     gccgccgcgg ctcccaccga cgcggcgccg tccgggccgg ccgggacccg cccgtcggcg       480
     tccgccacga cgccgacccc gtcggccgcc gccgcgcggg cgccgggagc cgccgctacc       540
     ggggcagcgg cggacctcgg cgccggctgg ccgtcggacc aggccgaagc cgtgatcgtc       600
     gtggacgatc tcgcgggcac cgtctggctg gtcgacccgt cgctgctgac gatcagcgcc       660
     tcggtcgcgc tgccgcccgg ggccgtcgtg ctcgccgcgg ccggggacgc ctacgcggtg       720
     gacgccgcca ccggccgggt gatccgcctc gacccgcgca cgctggccca gctcggcgcg       780
     ccgatcacct tcccggccgg gctggggacc gcggcccaga cgccggacgg gacgctgtgg       840
     gtgccggtcg cgagtgccgg cacggtcgtc ccggtccgcg ccgggacgcc ggggacgccg       900
     gttccggtgg cgccggcggg cgaccggctc gacgtcacga cggtcgccgg gtccgcggtg       960
     gtcgtcgacc agacggccgg cacggtcgtc cgcctcgcga tggaccacgc cgacgccgcg      1020
     atccggcttc cggacgcccc ggcgacctcc ggggccgcgg cccggctgct cctgccgacc      1080
     agcacagacg gccaggtcct ggcgctcgcc cagccggcga acggcgagtt gctgctcgcg      1140
     gacctcgcca ccgggcgggt cagcacgacg acgttgccgg ccgtcggagc ggcggacgtc      1200
     gacgtgtccg ccctcgcggc ggcgaccggc acgggcaccg gcgccgggca ccaggtcgga      1260
     gcgccggtct cccacgacgg ccaggtctac gtgcccgact cgaatgccgg cgtcgtctgg      1320
     gacttcgacc cgaagacggc ccggttcgcc gcgccggtgc cggtcgcgcc ggtcggcacc      1380
     ccgtcgcgga tcagcctgga cgtccagagc ggccagctct ggatcaatga cgagaccggc      1440
     ccgaccgtcg tcctggtcaa cggcgccagc cggcggaccc tgctgaagtt cggcgcggcc      1500
     ctgccgggag gcctccgcac gaacaccccg cgcccgctgc cacccggccc gacgccgacg      1560
     gccagccagt cgtcgtccca gggcggcggc acgggggcag gcggcacggg gtccggcggc      1620
     cggccgggcc tgatctggcc cggctggacc ccgtccagcc gacccggtac gcgaggcgac      1680
     ggcggcggcc gagcggacgg cacgggccgg ggcaccggcg ggcggggcga cgaccggacc      1740
     ggggctggaa acggccgtgg cggcggacag ccgggtgggc agaccggcga gccgaccggg      1800
     aaccggccga cgggccccgg ccagcccgag ccgccggcca gcaacaccgc ggccccgcca      1860
     cagccggagc cgaccgccgg tcagcagacg ccgggcgagc cgacgggctc gggcggaccc      1920
     ggcggcggcc agaccggcgg caccgaccag gccggtgcgg gcggtggtgt cggcaccggg      1980
     ggctcgcagg cggcgtccgg ggcgggcgtc gacggacagt cgccgaacca ggccggggac      2040
     ggggcaccgg ggcccgccga cccgccggcg gcccagccga cgacggcgcc cgcgcctacc      2100
     ggtccgccca gcggctcggc cggcgcgcca ggccatccga ccggccccgc gacgccgact      2160
     ccgtctccgg gccacgcgcc gaccccgccc gaccagggct cgccacggcc accggggttc      2220
     tggctgctca ccgccgacgg cacggtgctc gcccgtggca ccgcccaggc ggtcgccagc      2280
     accggcgccg accccggcgc tgtcgcgatc gcgccgaccg cgaccggccg gggctactgg      2340
     ctggtcgacg ccaccggcgc cggccgaccg gttggcgacg cgcccgccgt gccggccgcg      2400
     gccggcaccg gcacggtcgt ggcggccgcc gcggggccga ccggtggcgg gtactggacg      2460
     gtcaccgcca ccggcaccgt cgtcccgcac ggcacgctga ccggctacgg gtcgctgctc      2520
     tcggcgcccg gggcgccggt cgtcggcatc gcggccaccc cgaccggcgg tggctactgg      2580
     ctcctcgacg ccgccggcgg ggtctacccg ttcggggacg ccgaggcgat cgcccctggc      2640
     gcgcagccga ccggcccggc gaccggcccg cagcggtccg tcggcatcgc cgcgtcaccg      2700
     accggggccg gctactggac ggtcaccgcg gccggcctcg tcagcgcgca cggtggcgcc      2760
     ggcggctacg gctcggcgtc cgggtcgagc accgtcgtcg gcatcgcggc cacccccagc      2820
     ggccgcggct actggctcct tgacaccgcc ggcggcgcgc aggccttcgg cgacgccatc      2880
     acgaccgggg cgaccgccgc ggccggtacc cgggtcatcg cggtggccgc ggcgccatga      2940
//

If you have problems or comments...

PBIL Back to PBIL home page