(data stored in ACNUC7421 zone)

EMBL: CP002299.PE50

CP002299.PE50        Location/Qualifiers
FT   CDS_pept        57180..58106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0050"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /note="PFAM: dTDP-4-dehydrorhamnose reductase; KEGG:
FT                   geo:Geob_2135 dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78138"
FT                   /db_xref="GOA:E3J3D6"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3D6"
FT                   /inference="protein motif:PFAM:PF04321"
FT                   /protein_id="ADP78138.1"
FT                   /translation="MRVLVLGGAGMLGHELASALAGRHDVGVTVHGPRPPRRRDRSDPW
FT                   AGALPANRIFAGLDVRCQDDLAGLLADFRPEAVVNAVGLVKQRPEGRTALPAVEINTVF
FT                   PHRLARLCRIAGVRMVHVSSDCVFSGRRGRYTEDDQPDPVDVYGMSKLLGEIREAPVVT
FT                   LRTSIIGLEPAGRGSGLVEWFLAQTGQVSGYRRAIYTGLTTMEFARVVDRLLTKHEDLT
FT                   GLWHVATAEAITKHELLTRLADRLRRAGGSRAVAEVVAAEGPACDRSLLADRFAEATGY
FT                   TAPGWDAMLDELVERITLRDDGGRRDG"
     atgagagtgc tcgtgctcgg tggtgcgggg atgctcggac atgagctggc cagcgcgctc        60
     gccggtcgcc acgacgtcgg cgtgaccgtc cacgggccca ggccaccgcg ccgaagggac       120
     cggtctgacc cctgggccgg cgcgctgccc gccaaccgga tcttcgccgg cctggacgtc       180
     cgctgccagg acgacctcgc cgggctgctc gccgacttcc gccctgaggc ggtggtcaac       240
     gcggtcggcc tggtcaagca gcgccccgag ggcaggacgg cgctgcccgc tgtcgagatc       300
     aacaccgtgt tcccgcaccg gctggcccgg ctgtgccgga tcgcgggagt ccggatggtg       360
     cacgtcagct ccgactgcgt gttctccggc cggcgcggcc ggtacaccga ggacgaccag       420
     ccggacccgg tcgacgtgta cggcatgtcc aagctgctcg gggagatccg cgaggcgccg       480
     gtggtgaccc tgcggacgtc gatcatcggc ctcgagccgg ccggccgagg gtcgggcctg       540
     gtggagtggt tcctcgccca gaccggccag gtctccggct accggagggc catctacacc       600
     gggctcacca cgatggagtt cgcccgcgtc gtcgaccggc tgctgaccaa gcacgaggac       660
     ctcaccgggc tgtggcacgt cgcgacggcc gaggcgatca cgaagcacga gctgctgacc       720
     cggctcgccg accggctgcg ccgcgccggc ggttcccgcg cggttgccga ggtcgtcgcc       780
     gcggaggggc cggcctgcga ccggagcctg ctggccgacc ggttcgccga ggcgaccgga       840
     tacaccgcgc ccggttggga cgcgatgctc gacgagctcg tcgagcggat cacgctgcga       900
     gacgacggag gtcgccgtga tggctga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page