(data stored in ACNUC7421 zone)

EMBL: CP002299.PE503

CP002299.PE503       Location/Qualifiers
FT   CDS_pept        complement(626545..627243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0508"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   tfu:Tfu_1544 putative enoyl-CoA hydratase/isomerase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78591"
FT                   /db_xref="GOA:E3JB61"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB61"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADP78591.1"
FT                   /translation="MPKLEHDGEVYVLDLGDGENRFTKDWLVEVEALLSEIEATDGPKA
FT                   LVTVARGKIWSNGLDLDWMIAHTDELTDYLGSVQALFARVLTLPLVTVAALQGHAFAGG
FT                   AMLSLAHDFQVMRADRGFWCLPEVDLRLPFSVGMSSLISARLPARTAAEAMVTGRRYGG
FT                   ADALAAGIVDAIAAAGVTDASEAERAVETTAIEIARPLTGKASPALGVIKSRLYAATVA
FT                   ALHAMEPVSL"
     atgccgaagc tggagcacga cggcgaggtg tacgtgctgg atctcggcga cggcgagaac        60
     cggttcacca aggactggct tgtcgaggtc gaggcactgc tgtccgagat cgaggcgacg       120
     gatgggccaa aagcgctggt cacggtcgct cgcggcaaga tctggtcgaa tgggctggat       180
     ctcgactgga tgatcgccca caccgatgag ctgaccgact atctcggttc cgtccaggct       240
     ctgttcgccc gagtcctgac gctgccgctg gtcacggtcg ccgcgctgca gggccatgcc       300
     ttcgccgggg gcgcgatgct ctcgctcgca catgacttcc aggtgatgcg ggctgaccgt       360
     ggcttctggt gcctgcccga ggtcgacctg cggctgccgt tctccgtcgg gatgtccagc       420
     ctgatctccg cacgactgcc agcaaggacc gcggccgagg cgatggtcac cggtcgccgg       480
     tacggcgggg ccgacgccct ggctgccggc atcgtcgacg cgatcgccgc ggcgggtgtc       540
     acggacgcca gcgaggcgga acgcgcggtc gaaaccacgg cgatcgagat cgcccgcccg       600
     ctcaccggca aggcgtcacc ggccctcggc gtgatcaagt ccaggctgta cgcggcgacc       660
     gtggccgccc tgcacgccat ggagcccgtc agcctctga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page