(data stored in ACNUC7421 zone)

EMBL: CP002299.PE506

CP002299.PE506       Location/Qualifiers
FT   CDS_pept        629914..630747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0512"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccs:CCNA_00711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78594"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB64"
FT                   /inference="similar to AA sequence:KEGG:CCNA_00711"
FT                   /protein_id="ADP78594.1"
FT                   /translation="MLRQKVVEKPVVIEIERPVLRRKIVDRPFDVEIEKPVIRQKVVER
FT                   PVVIEIEKPVITEKVVERRVVVEKIVEKPVFKEKIVEKPVVVEKVVEKPVVREKVVEKP
FT                   AGGPGVRPSSGVGADPVRKEPPPVPKAPLTGGAPAHLAPRPTPPPPAGPKPAAPKPAPP
FT                   RPSGLVRPPGAPPAPLAPELAATGRPPAAGSGPRSGPDPNAPRPAQASQPAGGVSFVAP
FT                   TGGGPPDRGGPASGRLDNSTPIADLRSAARELSVNGWARLPKDELVEAIRKVNRR"
     gtgctgcggc agaaggtcgt cgaaaagccg gtggtgatcg agatcgaacg tccggtgctg        60
     cgccggaaga ttgtcgaccg gcccttcgac gtcgagatcg agaagccggt catccggcag       120
     aaggtcgtgg agcggccggt agtcatcgag atcgagaagc cggtgatcac ggagaaggtc       180
     gtcgaacggc gggtggtagt cgagaagatc gtagagaagc ctgtcttcaa ggagaagatc       240
     gttgagaagc cggtcgttgt cgagaaggtc gtcgagaagc ccgtggttcg cgagaaggtc       300
     gtcgagaagc cggccggcgg gcccggcgtt cggccgtcct ccggcgtcgg cgcggatccg       360
     gttcgcaagg agccgccgcc cgtcccgaag gctccgctga cgggcggggc cccggcgcac       420
     ctggccccca ggccgacgcc accgccccca gcggggccga agccggcggc acccaagccg       480
     gcgccaccga ggccgtcggg gctcgtccgg ccgcctggcg cgccgcccgc accactcgct       540
     ccggagctcg ccgcgaccgg caggccgccc gccgccggct ctggccctcg gtctggtccg       600
     gacccgaacg ctccacggcc tgctcaggcg agtcagccgg ccggcggtgt gagcttcgtg       660
     gctccgaccg gcggcgggcc gcccgatcgg ggcgggcccg cgagcgggcg gctggataat       720
     tcgacgccga tcgccgacct tcggtccgcc gcgcgcgaac tgtcggtcaa cggctgggcc       780
     cggctgccga aggatgagct ggtagaggcg atccgaaagg tcaaccgacg ctga             834
//

If you have problems or comments...

PBIL Back to PBIL home page