(data stored in ACNUC7421 zone)

EMBL: CP002299.PE512

CP002299.PE512       Location/Qualifiers
FT   CDS_pept        complement(641083..647166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0518"
FT                   /product="pentapeptide repeat protein"
FT                   /note="KEGG: sro:Sros_2975 WD40 repeatdomain-containing
FT                   protein-like protein; PFAM: pentapeptide repeat protein;
FT                   WD40 repeat, subgroup; SMART: WD-40 repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78600"
FT                   /db_xref="GOA:E3JB70"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB70"
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /protein_id="ADP78600.1"
FT                   /translation="MWGESAPTAGEVRRIFLSVAGPDERWGSWLDHVLRDAGYEVDFYR
FT                   RSFPLGANFVDQIDAALTRADRMIAVVSPAYLDRSSWVREEWQAGMRLAHTRDGFLLPV
FT                   LVEQCDLPPLLGTINMIVLLGLDRAKAVQTVLRGLVEPATGRPEPEHEPPFPGYEIAGP
FT                   AQRLALPAGAAALPALMAGPPEALGPTMPALGPTTPTPGFTASTPGFTASVPALPEPRA
FT                   DATLAAADRGGERTSITLLHLPALAAPTRPGHAPDTGPEPFGAPLLDDLAVLAASPGLT
FT                   PDLVVVTGVALEGRRGEYEQAAVRLALLADRLGLPVDRIALVPGRGDVSAAAARAYFAA
FT                   CEDEEIEPTAPYWRKWRHFVDFHANLYRELGERTFAVGQEWTLYPMADLRLVVAGLNST
FT                   MAMSHLQADDRGEVGQAQARWFADRLAGYERAGWFRLAVGHHPPLAADRVHSAKATDAY
FT                   GVDLILGGHVNLLLAAHGHGAPTPDGPLPAVPTRLPRSGTTLISAHPPHPVPTADTALR
FT                   YQILRISRAEVTRLDRRFSRRAGAWRPAEEVGAAGTVTYRTRWEHAATTFPRPTRRPPA
FT                   IEGPGSAGKAAARSSNGRKPTGEHRTDDPDSADGPGPRRGETFADRVAEIAELSSPGAT
FT                   ITRISPTGVAPEYLRVTVPHGPVFEQRPVGIAEDGVDESAVDRFVEHVHRQYAATDPQL
FT                   TSDLVYGGPLPAPDELVRQASVRGVRLRSFVEYQGLLDLRGYLRRQSDRLAADRLYPPA
FT                   LYLPQRFRVIDGGPVTADPTDAAPADTTPADTMLDGTLNGMVPTGDGSTDQASGPDGGD
FT                   LLGQLVDWLTADSARFVLILGDFGRGKTFCLHELARTLPERRPHLIPLLIDLRAMEKAH
FT                   SVDELVAAHLVASGEQRVDVSVFRYMLRRGRLVLLFDGFDELALRVTYETAAEHLGRLL
FT                   DAVEGQAKVVVTSRTQHFLSHGQVRGALGARVELLPASRIAEVGDFTERQIEEFLVRLH
FT                   HGDAARARERLELIHDIRDLLGLSHNPRMLGFIASLDTNRLRAVQARTGVISSADLYGE
FT                   LIEEWLRYEERRARPPGAGPALTAGERREAVTALALRLWRTTDQVINLSELTATTSTAL
FT                   DAMTDRVDAGQLDSSQAAHMVGSGSLLVRADDGGFTFIHQSVMEYLVAAAAAQRLADVD
FT                   DLGGGGDVLGARVMSPLMVDFLRGVAGDAAATAWARRALAEPEAGQAPRANALAIARRA
FT                   DPTAARGARLGGAHLEGADLTGLDLSDADLAGANLTDADLDDANLTGANLTGARLTGVR
FT                   ARRLRLTGANLTDADLRRARLTDPDLTGTVLTGSKWERAALLGATPPDRARTAPELAAA
FT                   AVPGRDPVEVVIDSGLRWTQALSPSHDLLAYGTGHHVALEDLADGHVLAVLRGRGEWIR
FT                   AVAFSADGSRLAAGDVAGGIQLWDVAAAEEVASFVGHASRVRALAFSPDGSLLATGCWE
FT                   GRVHVWDLATLTRVATLHKSADRIKTLQFSPDGTLLAYGDEVRLWDVRTRSDLSVLGKP
FT                   TEQARTLRFSPDGTLLAWVNGENTARVWNLAAGREVGRRRGDHHFARALAFDPSGSLVA
FT                   IGADDGTIRVWDLAGDSLRTTLRAARGWVTILEFVGAEGKALIAGTRDGTVQVWKVTDG
FT                   APPGRTLLTGRTADVLATAFVPEQSLVAAASENGSLRLWDTRTAAQVHIGSGEKAWCYA
FT                   MSLTDDATLLAAGGGDGLVRIYELSPGRAGDGRSDLDTPVRRLNTRRTPVRALAFSPDT
FT                   TILAVGHPDGTVGLWNPWTGHPMATLKAGGLRVLTVAFSPDGERLAAGTDTGTVHVWDA
FT                   VGARGGSAAAARRLVGHSDWVNAVAFSPDSELLASGSGSGTVRIWDAATGVLRNRLVGH
FT                   GGRVRTIAFAPDGRLLAAGGEDGIVRLWDPGTGSELARLAGHTEEIRSVAFNAAGDVLV
FT                   SGGADGTARLWQVGDSHRSDGSRELATMLGLAGNRWTALFPDGSYKTSEDRDADSVRTV
FT                   WWSIRLSRFDPDELTPYLPRIRRRPLEAPLATPPS"
     gtgtggggag agtctgctcc gaccgcgggt gaggtgcggc ggatctttct cagcgtggcg        60
     gggccggacg agcgctgggg cagctggctg gatcatgtgc tgcgcgacgc cggctacgag       120
     gtcgacttct accggcgctc gttcccgctc ggcgccaact tcgtcgacca gatagacgcc       180
     gcgctcaccc gggccgaccg gatgatcgcg gtcgtctcgc cggcctacct cgaccggtcc       240
     tcctgggtgc gggaggaatg gcaggcgggc atgcggctgg cgcacacccg cgacggcttc       300
     ctgctgccgg tgctggtcga gcagtgcgac ctgccgccac tgctcggcac gatcaacatg       360
     atcgtgctgc tcggcctgga ccgcgcgaag gcggtgcaga ccgtgctgcg cgggctggtc       420
     gagccggcga ccggccggcc cgagccggag cacgagccgc ccttcccggg ctacgagatc       480
     gccgggccgg cccagcggct cgcgctgccg gccggcgcgg ccgcgctacc cgccctgatg       540
     gccgggccgc ctgaggcact cggccccacc atgccggctc tcggccccac cacgccgacg       600
     cccggattca ccgcgtcgac gcccggcttc accgcgtcgg tgccggccct gccggagcca       660
     cgagccgatg ccacgctcgc cgcggccgac cgcggcgggg agcggacgtc gatcacgctg       720
     ctgcacctgc ccgcgctcgc cgcgccgacg cggcccgggc acgcgccgga caccggcccg       780
     gaaccgttcg gcgccccgct gctcgacgac ctggccgtgc tcgccgccag ccccggtctc       840
     accccggacc tcgtcgtggt caccggggtc gccctggagg gccggcgtgg cgagtacgag       900
     caggccgcgg tgcggctggc gctgctcgcc gaccggctgg gcctgccggt cgaccggatc       960
     gccctggtcc cgggccgggg cgacgtgagc gccgcggccg cccgcgccta cttcgccgcc      1020
     tgcgaggacg aggagatcga gccgacggca ccgtactggc gcaagtggcg gcacttcgtc      1080
     gacttccacg cgaacctcta ccgggagctc ggtgagcgga ctttcgcggt ggggcaggag      1140
     tggacgctct acccgatggc ggacctgcgg ctcgtcgtcg ccgggctgaa ctccacgatg      1200
     gcgatgagcc acctgcaggc ggatgaccgc ggcgaggtcg gccaggccca ggcccgctgg      1260
     ttcgccgacc ggctcgccgg ctacgagcgc gccggctggt tccggctcgc cgtcggccac      1320
     cacccaccgc tggccgccga ccgggtccac tcggcgaagg cgaccgacgc ctacggggtc      1380
     gacctgatcc tcggcgggca cgtcaacctc ctgctcgccg cgcacgggca cggcgcgccg      1440
     acgccggacg gcccgctgcc ggcggtgccg acccggctgc cgcgctccgg gacgacgctg      1500
     atcagcgcgc acccgccgca cccggtgccc accgccgaca ccgcgctgcg ctaccagatc      1560
     ctgcggatca gccgcgcgga ggtgaccagg ctggaccggc gcttctcccg ccgggccggc      1620
     gcctggcggc ccgccgagga ggtcggcgcc gctgggaccg tcacctaccg gacccgctgg      1680
     gagcacgccg ccaccacgtt cccccgccca acccgccggc caccggccat cgagggcccc      1740
     ggctcggccg gcaaggccgc cgcacgctcg agcaacgggc gcaagcccac cggcgagcac      1800
     cgcaccgacg acccggacag tgcggacggg cccggcccgc ggcgcggcga gacgttcgcc      1860
     gaccgggtcg cggagatcgc cgagctctcc tcccccggcg cgacgatcac cagaatctcg      1920
     ccgaccggcg tcgcccccga gtacctgagg gtgaccgtgc cacacgggcc ggtgttcgag      1980
     cagcgcccgg tcgggatcgc cgaggacggc gtcgacgaga gcgccgtgga ccggttcgtc      2040
     gagcatgtgc accgccagta cgcggcgacc gacccccagc tgacctccga cctcgtctac      2100
     ggcggcccac tgccggcgcc cgacgagctg gtccgccagg cgtccgtgcg cggtgtgcgg      2160
     ctgcgcagct tcgtggagta ccagggcctg ctggacctgc gcggctacct gcgccggcag      2220
     agcgaccggc tggccgcgga ccggctctac ccgccggcgc tctacctgcc gcagcggttc      2280
     cgggtgatcg acggcggccc ggtcaccgcc gacccgaccg acgccgcccc ggccgacacc      2340
     accccagccg acaccatgct cgacggcacg ctcaacggga tggtgccaac cggcgacggc      2400
     agcaccgacc aggcgagcgg ccccgacggc ggtgacctgc tcggccagct ggtcgactgg      2460
     ctgaccgccg actcggcgcg gttcgtcctg atcctgggcg acttcggccg cggcaagacg      2520
     ttctgcctgc acgagctggc ccgcaccctg cccgaacgcc gcccacacct gatcccgctg      2580
     ctgatcgacc tgcgcgcgat ggagaaggcg cacagcgtcg acgagctggt cgcggcccac      2640
     ctggtcgcct ccggcgagca gcgggtcgac gtgtcggtct tccggtacat gctgcgccgc      2700
     ggccggctgg tgctgctctt cgacgggttc gacgagctcg cgctgcgggt cacctacgag      2760
     accgctgccg agcacctggg ccggctgctg gacgccgtcg agggccaggc caaggtcgtc      2820
     gtgaccagcc ggacccagca cttcctgtcc cacggccagg tccgcggggc gctcggcgcc      2880
     cgggtcgagc tgctgccggc cagccggatc gccgaggtcg gcgacttcac cgagcgccag      2940
     atcgaggagt tcctcgtccg gctgcaccac ggcgacgccg cgcgggctcg ggagcggctc      3000
     gaactgatcc acgacatcag ggacctgctc gggctgtccc acaacccgcg gatgctcggc      3060
     ttcatcgcgt cgctcgacac gaaccggctg cgtgccgtcc aggccagaac cggtgtgatc      3120
     agctcagcgg acctgtacgg cgagctgatc gaggagtggc tgcgctacga ggaacgccgg      3180
     gcccgcccgc ccggcgccgg gccggcgctg acggccggcg agcgccggga ggccgtcacc      3240
     gcgctcgcgc tgcggctctg gcggacgacc gaccaggtga tcaacctctc agagctcacc      3300
     gcgacgacca gcacggccct cgacgcgatg acggaccggg tcgacgccgg ccagctcgac      3360
     tccagccagg ccgcgcacat ggtcggctcg ggcagcctgc tggtccgcgc cgacgacggc      3420
     ggcttcacct tcatccacca gtcggtgatg gagtacctgg tcgccgcggc ggccgcccag      3480
     cggctcgccg acgtcgacga cctgggcggt ggcggcgacg tgctgggcgc gcgggtgatg      3540
     tcgccgctca tggtcgactt cctgcgcggc gtggccggtg acgccgcggc gacagcctgg      3600
     gcgcggcgag ctctggccga gccggaggcc ggccaggcgc cccgggcgaa cgcgctcgcg      3660
     atcgcgcgcc gcgccgaccc gacggcggcc cgcggcgcgc ggctcggcgg ggcccatctg      3720
     gagggcgccg acctgaccgg cctcgacctc agcgacgccg acctggccgg cgcgaacctc      3780
     accgacgccg acctcgacga cgcgaacctg accggcgcga acctcacggg ggcgcggctg      3840
     accggagtcc gcgcccgccg cctgcggctg accggcgcga acctcaccga cgccgacctg      3900
     cgccgggccc gcctcaccga ccccgacctg accggcaccg tcctcaccgg cagcaagtgg      3960
     gaacgggccg cgctgctcgg cgcgaccccg ccggaccggg cacggacggc cccagagctc      4020
     gccgccgccg cggtcccggg ccgcgacccc gtggaggtcg tcatcgactc gggcctgcgc      4080
     tggacccagg cgctctcgcc gtcccacgac ctgctcgcct acggaaccgg gcaccacgtc      4140
     gcgctggagg acctcgccga cgggcacgtg ctggcggtgc tgcgcgggcg cggcgagtgg      4200
     atccgcgcgg tcgcgttctc cgccgacggc tcgcggctcg cggcgggcga cgtcgccggc      4260
     ggcatccagc tctgggacgt cgccgcggcc gaggaggtcg cgagcttcgt cgggcacgcc      4320
     agccgggtgc gcgcgctcgc gttctcccct gacggctcgc tgctggcgac cggctgctgg      4380
     gagggcaggg tgcacgtctg ggacctggcc acgctgacca gggtcgcgac gctgcacaag      4440
     tcggcggacc gcatcaagac gctgcagttc tccccggacg ggacgctgct ggcctacggc      4500
     gacgaggtac gcctctggga cgtgcgcacc cgcagcgacc tctcggtgct cggcaagccc      4560
     accgagcagg cgcgcacgct gcgcttctcc ccagacggaa ccctgctggc ctgggtcaac      4620
     ggggagaaca cggcccgggt ctggaacctc gccgccgggc gtgaggtggg ccgccggcgc      4680
     ggcgaccatc atttcgcccg cgccctcgcg ttcgacccga gtggctcgct cgtcgcgatc      4740
     ggcgccgacg acggcacgat ccgggtgtgg gacctggccg gcgacagcct gcgcacgacg      4800
     ctgcgcgcgg cccgcggctg ggtgacgatc ctggagttcg tcggcgccga ggggaaggcg      4860
     ttgatcgcgg gcaccaggga cggaaccgtc caggtctgga aggtcaccga cggcgccccg      4920
     ccgggacgga cgctgctcac cggccgcacc gcggacgtgc tcgccacggc cttcgtgccc      4980
     gaacagtcgc tggtcgccgc cgccagcgag aacggctcgc tgcggctctg ggacaccagg      5040
     accgccgccc aggtgcacat cggctcgggc gagaaggcct ggtgctacgc gatgagcctg      5100
     accgacgacg ccaccctgct cgccgccggt ggcggtgacg gcctggtccg gatctacgag      5160
     ctgtcccccg gccgggccgg cgacggccga agcgacctgg acacgccggt gcgccggctg      5220
     aacaccaggc ggacccccgt gcgcgcgctc gccttctccc cggacacgac gatcctcgcg      5280
     gtcggtcatc ccgacgggac cgtgggcctc tggaacccgt ggaccggcca tccgatggcg      5340
     accttgaagg ccggcggcct tcgggtgctc acggtcgcgt tctcaccgga cggcgagcgg      5400
     ctcgcggccg gcaccgacac cggtacggtg cacgtctggg acgcggtggg ggcgcgtggc      5460
     gggtcggctg cggcggcccg ccgcctcgtc ggccactcgg actgggtcaa cgcggtggcg      5520
     ttctcccccg acagcgagct gctcgcgagc ggctcggggt cgggcacggt gcggatctgg      5580
     gacgccgcca ccggggtgct gcgcaatcgc ctcgtcggcc acggcggccg ggtacggacc      5640
     atcgccttcg ccccggacgg ccggctgctc gcggccggcg gcgaggacgg catcgtccgg      5700
     ctctgggatc cgggcaccgg cagcgagctg gctcgtctgg ccgggcatac cgaggagatc      5760
     cggtcggtcg cgttcaacgc ggcgggtgac gtgctggtat ccggcggcgc cgacggcacc      5820
     gcccggttgt ggcaggtcgg cgacagtcac cggagtgacg gaagccggga gctcgccacg      5880
     atgctcgggc tggccggcaa ccggtggacg gcgctgttcc ccgacggttc gtacaagacc      5940
     tcagaggacc gtgacgccga ctccgtcagg accgtctggt ggtcgatcag actgagccgg      6000
     ttcgacccgg acgagctgac gccctacctc ccgcggatcc gccggcgccc gctggaggca      6060
     ccgctggcga ccccgccgtc ctga                                             6084
//

If you have problems or comments...

PBIL Back to PBIL home page