(data stored in ACNUC7421 zone)

EMBL: CP002299.PE514

CP002299.PE514       Location/Qualifiers
FT   CDS_pept        complement(648201..650459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0520"
FT                   /product="apoptosis regulator Bcl-2 protein BH"
FT                   /note="SMART: apoptosis regulator Bcl-2 protein BH; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78602"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB72"
FT                   /inference="protein motif:SMART:SM00337"
FT                   /protein_id="ADP78602.1"
FT                   /translation="MFGAALHAARVVFKVSGGNLNFGSQFTGTAGAAGAGSGGVPGIIS
FT                   QPELARVVGAFVAAPCHGQLYKKLADNHLVVLRAAPGWGRTATAEYLLYECLTTSSGHP
FT                   PSPVPRGLDLHPAAVAQVRISRLNASTDLRGLTSDHLRPAGDEENPQPGGLLLDVATPH
FT                   GAGLLRGSDLERLANVLRANRDYLVVTVDAGTVFGDELDEFLIDADEPPPAIRVVARHA
FT                   ARRLGRPYPDVLDEARESTELSGLVDQLVGEGYSAAGLAQLGRIWAEQGSERGSQKATD
FT                   TLRQWVTDFIEARFADWLAAPGQDPEHRAFVIALAVFDGMPYAKVTRLARDLEDRMLIA
FT                   SRRFLRPAPLETWGFDPAPHERSDPYASQPLFTRPRSGRLAAASAEVRVGTETTRYGST
FT                   ETEVVAFTCANYPSRILFWLWTEQDALHSVLLRWLAALGEDTDPAVRAHAAAAVGVLAS
FT                   WSFDEILLRVLLPWADDDLPWQRGAVAAALSLALDWRPGLAPVVIEMLRDWKMHTQHPA
FT                   RRLAAIRVWGTSLGPFDPDVALDQLAYLMAPLEDAEEDENPEDVDLNVIDNVSLSVFEI
FT                   FSAPLIAVHGETDRPTRPGGATDAVLRRLGVWTEPGSGPTQRFAGILAFLRLALHLRLG
FT                   VDSPGQGSPALLTLCMPGRGDRLTLRRIAELWRRALDEPATNQLALDCLRQWTADTEAD
FT                   DDLARTTFAHLVWESLRSRADFDRLQREFRRWEKRWPRTCQVVLATIERSTNGDSGGL"
     atgttcggcg cggcgctgca cgcggcgcgg gtcgtcttca aggtttccgg tggcaacctc        60
     aacttcggga gccagttcac gggaacggcg ggcgcggcgg gcgccggctc cggtggagtc       120
     cctggaatca tcagccagcc cgagttggcc cgggtcgtcg gggcgttcgt tgccgcgccc       180
     tgtcacggac agctgtacaa gaagctggcg gacaatcatc tggtggtcct gcgtgccgcc       240
     cctggctggg ggcgcaccgc cactgcggag tatttgctgt acgagtgcct cacgacctcg       300
     tcgggccatc ccccgtcgcc cgtcccgcgc ggcctggacc ttcacccagc agcagtcgcc       360
     caggtccgta ttagccggct caatgccagc accgacctgc gtggactgac ttcagaccat       420
     ctccggccag ccggcgacga ggagaatccg cagccggggg gccttcttct tgatgtcgcg       480
     acgccgcacg gcgccggcct gctccgcggc agcgacctcg aacggctggc gaacgtgctt       540
     cgcgcgaacc gcgactacct ggtggtcacg gtcgacgcgg gtacagtctt cggcgacgag       600
     ctcgacgagt ttctcatcga cgcggacgag ccgccaccag ccatccgggt ggtcgcccgg       660
     catgccgcgc ggcgcctcgg ccggccgtat ccggacgtac tcgacgaggc gcgagagagc       720
     acggagctga gcgggctcgt agaccagctg gtcggcgagg gctacagcgc tgccgggctc       780
     gcccagctcg gacggatctg ggccgaacag ggttccgagc gaggctcgca gaaggcaacc       840
     gacacgctgc ggcaatgggt cacagacttc atcgaggccc gcttcgcgga ctggctggcg       900
     gcgcctgggc aggacccgga acatcgcgcg tttgtaatcg cccttgccgt cttcgatgga       960
     atgccctacg cgaaggtcac tcgccttgcg cgcgatctcg aagaccgaat gctgatcgcc      1020
     tcccgtcgtt tcctgcgtcc cgcccctctc gagacctggg gattcgaccc cgctccgcac      1080
     gagcgatccg acccgtacgc cagccagccg ctgttcaccc ggccgcggtc gggtcggctc      1140
     gcggcggcgt ccgccgaggt aagagtcggc acagagacca cccgatatgg ctcaaccgag      1200
     accgaggtcg tggccttcac ctgtgccaac tacccgtcgc ggattctgtt ctggctctgg      1260
     acggagcagg acgcgctgca ctccgtccta ctcaggtggc tggcggcgct gggcgaggac      1320
     accgacccag cggtccgggc gcacgccgcc gccgcggtcg gcgtgctggc cagctggtcc      1380
     ttcgacgaga tcctgctgcg ggtgctcctg ccgtgggcgg acgacgacct gccctggcag      1440
     cggggcgccg tcgccgccgc gctgagcctg gcgctggact ggcgccccgg gctggcgccg      1500
     gtggtcatcg agatgctccg cgactggaag atgcacaccc agcaccccgc aagacgcctg      1560
     gcggcgatcc gggtctgggg aacgagtctg gggccgtttg acccagacgt cgcgctcgat      1620
     cagctggcgt atctgatggc tccgctggaa gacgcagagg aagatgagaa tcccgaggac      1680
     gtcgatctca acgtgatcga caacgtctct ctgagtgtct tcgagatttt ctccgctccg      1740
     ctgatcgccg tgcacggtga gaccgaccgg ccgacgcgac cgggcggcgc caccgacgcg      1800
     gtgctgcgtc ggctcggggt gtggaccgag cccggcagcg ggccgaccca gcggttcgcc      1860
     ggcatcctcg cctttctgcg actcgcactt catctccgcc ttggagtcga cagtcctggc      1920
     caaggcagcc cggcgctgct cacgctgtgc atgcccggcc gcggagaccg gctcacgctg      1980
     cgtcggatcg ctgagctgtg gcggcgggcg ctcgacgagc cggccactaa ccagctggcc      2040
     ctcgactgcc tgcggcagtg gaccgcggac accgaggcgg acgacgacct cgcccggacg      2100
     acattcgcgc atcttgtctg ggagtcgctg cgcagccgtg ccgatttcga ccgactccaa      2160
     cgagagttcc gccgctggga gaaacgctgg ccacgcacgt gtcaggtcgt cctcgcaacg      2220
     atcgagaggt ccacgaacgg agacagcggt ggtctataa                             2259
//

If you have problems or comments...

PBIL Back to PBIL home page