(data stored in ACNUC7421 zone)

EMBL: CP002299.PE515

CP002299.PE515       Location/Qualifiers
FT   CDS_pept        650941..651912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0521"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0801 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78603"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB73"
FT                   /inference="similar to AA sequence:KEGG:FRAAL0801"
FT                   /protein_id="ADP78603.1"
FT                   /translation="MTQQLSDLELRTLAEVYFDRWAGGELLKRAGLSPADQPQGAGIVL
FT                   DFWRQVNASLGAGILADGRRRILAAAAADYPANEVFRRGLSDAATSGRPGGDPATPVSR
FT                   GDLASEPDEAGGAGATLRAARMEFKVSGGNVNFGHQGRVVGSSAPVSSREGLDARARSQ
FT                   RHPDSGSPDRTAPDVLVLADAEDESWGQWVAWHLHADGYRVELDDWSQYLADQAGLLLA
FT                   DAVRATSLTILVRGHGDPVWSASYFQLAGFQELAVKKRGRIVGVRVSAHAADVVPMDGV
FT                   TFVDLVGLGENESAARLTAAVRRLLTGWEPTAVKPAFPGDGP"
     gtgacgcagc agctgtctga tctggagctg agaacgctcg ccgaggtcta cttcgatcga        60
     tgggccgggg gggagctcct caagcgggcc ggcctttcac ctgctgacca gccacagggt       120
     gccgggatcg tgctggattt ctggcgccag gtgaacgcct cgctcggcgc cggcatcctg       180
     gcggacggcc ggcgccggat cctcgccgcc gcggcggccg actacccggc caatgaggtc       240
     ttccggcgtg ggctctcgga cgcagcgacg tcgggccggc cgggtggcga tccggctacc       300
     ccggtgtcgc gcggcgacct cgcgtcagag ccggacgagg ccggcggcgc cggcgcaacg       360
     ctgcgtgcgg cgcggatgga gttcaaggtc tccggcggca acgtcaactt cggccatcag       420
     ggcagggttg tcggatccag cgcgccggtc tcgtcccgtg agggcctaga cgcacgggca       480
     cggtcgcagc ggcatccaga cagtggctct cctgaccgga ccgcgccgga tgtcctggtg       540
     ctggccgacg cggaggacga gagctggggc cagtgggttg cctggcacct gcacgccgac       600
     ggttaccgag tggaactcga cgactggtcc cagtacctcg ctgatcaggc cggtctcctt       660
     ctggccgacg cggtccgcgc gacaagcctg accattctcg tgcgcggcca tggggatccc       720
     gtctggtctg cctcctattt ccagctcgcc ggttttcagg agctcgcggt gaaaaagcga       780
     ggaagaatcg tcggcgtgcg cgtcagcgcc cacgccgctg acgtcgttcc catggatgga       840
     gtgacctttg tcgatctagt cgggctgggt gagaacgagt ccgcggcacg gttgacggcg       900
     gcggttcgtc gcctgctcac cggttgggag ccgacggccg tgaaaccggc cttccctggt       960
     gatgggccct aa                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page