(data stored in ACNUC7421 zone)

EMBL: CP002299.PE52

CP002299.PE52        Location/Qualifiers
FT   CDS_pept        58225..59550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0052"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine 2-epimerase; KEGG:
FT                   fal:FRAAL2071 UDP-N-acetylglucosamine 2-epimerase; PFAM:
FT                   UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78140"
FT                   /db_xref="GOA:E3J3D8"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3D8"
FT                   /inference="protein motif:TFAM:TIGR00236"
FT                   /protein_id="ADP78140.1"
FT                   /translation="MQSTYQWPARVAPTRVKVMVIVGTRPEVIKLSRVIAALERHVDVR
FT                   LVHSGQNHAYELGQIFFDELGIRPPDHHLDAVLPGATAADTIGQVIARVDRVLAAERPD
FT                   AVLLYGDTNTCLAVIPAKRRHIPVFHMEAGNRCFDDRVPEEINRRLVDHLSDVNLPLTE
FT                   HARRHLLAEGLPANRVFVTGSPMKEVLTQHWAQIEGSTVLADLGLTVGRFLVVSAHREE
FT                   NVDHPDLLRALLATLTVLADRFDMPVVVSTHPRTRARLDELGADAFAAPGGPSAVADLD
FT                   PRVRFLRPFGLADYVALQRGAHCVISDSGTLTEEAALLGFPAVMIRESHERPEGFDHGV
FT                   LVSSVLRPDRVLAAVAAVTDQPTGQRGGGQTQLGPSGLAAGNSGRGLPPDYDVDDVSTR
FT                   VLRIILSYVDQVNRTVWHRSPAPVAVPAPRAALEPDVALTSG"
     atgcaatcga cctaccagtg gccggcgcga gtagcgccta cccgggtcaa ggtgatggtc        60
     atcgtcggga ccagaccgga ggtcatcaag ctcagccggg tgatcgccgc gctggagcgg       120
     cacgtcgacg tccgactggt ccactccggg cagaaccacg cctacgagct gggccagatc       180
     ttcttcgacg agctgggcat ccgcccgccc gaccaccacc tggacgcggt gctgcccggc       240
     gcgacggcgg cggacacgat cggccaggtg atcgccaggg tggaccgggt gctggcggcc       300
     gaacgccccg acgccgtgct gctctacggc gacaccaaca cctgcctggc ggtgatcccg       360
     gccaagcggc ggcacatccc ggtgttccac atggaggccg gaaaccgctg cttcgacgac       420
     cgggtcccgg aggagatcaa ccgcaggctc gtcgaccacc tcagtgacgt gaacctgccg       480
     ctcacggagc acgcgcgccg ccatctgctg gccgagggcc tgcccgcgaa ccgggtgttc       540
     gtgaccgggt cgccgatgaa agaggtcctc acccagcact gggcccagat cgagggctcc       600
     acggtccttg ccgacctggg gctgacggtg gggcgtttcc tggtggtcag cgcgcatcgc       660
     gaggagaacg tcgaccatcc cgacctgctg cgcgcgctgc tggccactct gacggtgctg       720
     gccgaccgat tcgacatgcc ggtcgtcgtc tcgacgcacc cgcggacccg ggcccggctt       780
     gacgagttgg gcgccgacgc gttcgcggcc cccggcggcc cctcggcggt cgccgacctt       840
     gacccgcggg tgcgcttcct acggccgttc gggctggcgg actacgtcgc gctgcagcgg       900
     ggggcgcact gcgtgatctc cgacagcggc acgctcaccg aggaggccgc cctgctcggc       960
     ttcccggccg tcatgatccg agagtcgcac gagcggccgg agggcttcga ccacggtgtg      1020
     ctggtgtcca gcgtgctgcg gccggaccgg gtcctcgccg cggtcgccgc ggtgaccgac      1080
     cagccgacgg gacagcgcgg cggcgggcag acccagctcg gcccgtccgg gcttgcggct      1140
     ggtaactcgg gccgtgggct gccgcccgac tacgacgtcg acgacgtctc cacgcgggtc      1200
     ctgcggatca tcctgagcta tgtcgaccag gtgaaccgga ccgtctggca tcgctcgccg      1260
     gccccggtgg ccgtgccggc gccgcgcgcc gcgctggaac ccgacgtggc cctcacctcc      1320
     gggtga                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page