(data stored in ACNUC7421 zone)

EMBL: CP002299.PE522

CP002299.PE522       Location/Qualifiers
FT   CDS_pept        665195..665836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0528"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: fal:FRAAL6413 two-component regulator; PFAM:
FT                   response regulator receiver; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78610"
FT                   /db_xref="GOA:E3JB80"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB80"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADP78610.1"
FT                   /translation="MTERTGGPVDPGGGPSTERPRSKILLVDDRPDNLMALEAILASLD
FT                   QELVTASSGEEALKRLLVDDFAVILLDVQMPGMDGFETAHRIKQRGRTRDTPIIFLTAI
FT                   DREPHHAFRGYAVGAVDYIAKPFDPWLLRAKVSVFVELFEKNERLGELVHQRGQDFDLM
FT                   TEVAERLIALDVLLEGARDASPEEIIAAAGAEVRGLVARMSPFARSTPTT"
     gtgaccgagc ggaccggcgg tcctgtcgac ccaggaggcg ggccgagcac ggaacggccg        60
     cggagcaaga tcctgttggt tgacgaccgg cccgacaacc tgatggcgct ggaggcgatc       120
     ctcgcgtcgc tggaccagga gctcgtcacc gcctcctctg gcgaggaggc gctcaagcgg       180
     ctgctcgtcg acgacttcgc ggtgatcctg ctcgacgtcc agatgcccgg catggacggc       240
     ttcgagacgg cccaccggat caagcagcgc ggccggacca gggatacccc gatcatcttc       300
     ctcacggcga tcgaccgcga gccgcatcat gccttccgcg gctacgccgt cggcgccgtc       360
     gactacatcg ccaagccgtt cgacccgtgg ctgctgcggg cgaaggtgag cgtcttcgtc       420
     gagctgttcg agaagaacga acggctcggc gaactcgtcc accagcgcgg ccaggatttc       480
     gacctgatga ccgaggtcgc cgaacggctg atcgcgttgg acgtgctgct ggagggcgcc       540
     cgggacgcct cgcccgaaga gatcatcgcc gccgccggcg ccgaggtccg cggcctcgtc       600
     gcccgcatga gccccttcgc ccgctccacc ccgaccacct ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page