(data stored in ACNUC7421 zone)

EMBL: CP002299.PE529

CP002299.PE529       Location/Qualifiers
FT   CDS_pept        complement(672917..673726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0535"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: fal:FRAAL6405 putative transcriptional
FT                   regulatory protein; PFAM: GntR domain protein; regulatory
FT                   protein GntR HTH; SMART: GntR domain protein; regulatory
FT                   protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78617"
FT                   /db_xref="GOA:E3JB87"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB87"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADP78617.1"
FT                   /translation="MTPTQPPTARPSSAQPTAGRPSTAQAPTERFTPRPPSARNATTGN
FT                   LREHAYVGLRQRLMAGEFSFRDRLTEERLAALLGVSRTPVREALTRLAGDGLVEKRLDG
FT                   GYYPAEPDLDGLRDLYEIRVVLELHSLERALESGVPHDPALLEPLRENWEALRQAPPDP
FT                   DPSFVALDEGFHLTLCRASGNVELANMLDAINARIRPVRMHDFLTEDRIHMTIEQHLDI
FT                   VETVLGGDLPEAVRKLRNHVGESMEVVEKRAASAITQMALRRGRSPR"
     atgacaccga cgcagccgcc gacggcccga ccgtcgagtg cgcaaccgac cgcggggcgg        60
     ccgtcgactg cgcaggcgcc caccgagcga ttcaccccgc gaccgccatc ggcccgcaac       120
     gccacgaccg gcaacctgcg ggaacacgcc tacgtcgggc tgcgacagcg gctgatggcg       180
     ggcgagttct ccttccgcga ccggctgacc gaggagcggc tcgcggccct gctcggggtc       240
     tcccggacgc cggtgcgcga ggcgctcacc cggctggccg gggacgggct ggtcgagaag       300
     cggctggacg ggggctacta cccggccgag ccggatctcg acggcctgcg cgacctctac       360
     gagattcggg tcgtcctcga gctacacagc ctggaacgcg cgctggaatc cggcgtcccg       420
     cacgaccccg cgctgctgga accgctgcgc gagaactggg aggcgctgcg tcaggcgccg       480
     cccgaccctg acccctcctt tgtcgcgctt gacgaaggat tccatctcac actctgccgt       540
     gcgtctggca acgtcgagct ggccaacatg ctcgacgcca tcaacgccag gatccggccc       600
     gttcggatgc acgacttcct caccgaagac cgcatccaca tgaccattga gcagcatctc       660
     gacatcgtcg agacggtgct cggcggcgac ctgcccgagg cggtgcgcaa gctgcgcaac       720
     cacgtcggcg agtcgatgga ggtcgtggag aagcgggccg ctagcgcaat cacccagatg       780
     gcgctccgcc gaggccgctc gccgcgctga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page