(data stored in ACNUC7421 zone)

EMBL: CP002299.PE530

CP002299.PE530       Location/Qualifiers
FT   CDS_pept        674175..674939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0536"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6404 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78618"
FT                   /db_xref="GOA:E3JB88"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB88"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6404"
FT                   /protein_id="ADP78618.1"
FT                   /translation="MGTITARTTPAPSFLLLHGAATTGAIWAGVRRALGDRPAFAPDRP
FT                   SSGDLDSELAAVREAVALAAAATPAAARSVDAPAPPRLAAGAAVTTTREGPRAVVFGGV
FT                   SGGATLGLAALATGVPLAAAVLHEPAVGSLLPGLLAPMAAAYASGGVAAFASALYGPSW
FT                   RPTDGPADPDAVARDLSMFLRFEPAAPGPTPGPVVVTVGERSPEIRHRAAAALHRELGL
FT                   EVRVLAGCGHAAHLEAPAQFADLLAEIAATLG"
     gtggggacga tcacggccag aacgacgccc gctccgtcgt tcctgctgct ccacggggcg        60
     gcgaccacgg gcgcgatctg ggccggcgtg cgccgcgcgc tgggggaccg accggcgttc       120
     gcgcccgacc ggccgtccag cggcgatctc gacagcgagc tggccgcggt ccgcgaggcc       180
     gtcgccctgg ccgccgccgc gacgccggcc gccgcccgct ccgtcgacgc ccccgcgccg       240
     ccccggctgg ccgcgggcgc ggccgtcacc acgaccaggg aggggccgcg ggcagtcgtg       300
     ttcggcgggg tgagcggtgg cgcgacgctg ggcctggccg cgctcgcgac cggcgtgccg       360
     ctggccgccg cggtcctgca cgagccggcc gtcggctcgc tgctgccggg gctgctcgcg       420
     ccgatggccg cggcctacgc gagcggcggc gtcgccgcct tcgcgagcgc gctctacggt       480
     cccagctggc ggccgaccga cgggccggcc gatcccgacg ccgtggcgcg cgatctgtcg       540
     atgttcctgc gcttcgaacc ggccgccccc gggcccaccc cgggcccggt cgtcgtcacg       600
     gtcggcgagc gctcaccgga gatccggcac cgcgcggcgg cggcgctgca ccgcgagctc       660
     gggctggagg tccgggtgct ggcgggctgt gggcacgcgg ctcaccttga ggccccggct       720
     cagttcgccg acctgctcgc cgagatcgcc gccacgctgg gctga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page