(data stored in ACNUC7421 zone)

EMBL: CP002299.PE535

CP002299.PE535       Location/Qualifiers
FT   CDS_pept        677668..678588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0541"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /note="KEGG: fal:FRAAL6397 UTP--glucose-1-phosphate
FT                   uridylyltransferase; TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78623"
FT                   /db_xref="GOA:E3JB93"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB93"
FT                   /inference="protein motif:TFAM:TIGR01099"
FT                   /protein_id="ADP78623.1"
FT                   /translation="MPVTKAVIPAAGLGTRFLPATKAVPKEMLPVVDRPAIEYVVEEAA
FT                   RAGLRDVLLVTSRSKKAVEDHFDRDAELELALERKGDGARLARVRGSAELAEVHSVRQG
FT                   APRGLGHAVLCGAPHVGDEPFAVLLGDDLIDERDPLLEEMLAVQERFGGSVIALMEVPE
FT                   EVVSLYGVATVDPAPVAAGGRYETVRIRDLVEKPPADEAPSNLAIIGRYVLAPKVFEVL
FT                   RRTPPGRGGEIQLTDALRELAQAADEVGEPVHGVVFTGRRYDTGDRVDYLKAVIRLACE
FT                   RADLGPEIYPWLEEYVANGGPKADN"
     atgccagtga cgaaggcggt tattccggct gcgggcctcg ggacccggtt ccttccggcg        60
     acgaaggccg tgccgaagga gatgctgccc gtcgtagacc gcccggccat cgaatacgtg       120
     gtcgaagagg ccgcccgcgc cggcctgcgg gacgttctgc tcgtcaccag ccggtcgaag       180
     aaggccgtcg aggaccactt cgaccgcgat gcggagctgg agctggcgct ggagcgcaag       240
     ggcgacgggg cccggctcgc gcgggtgcgt gggtccgcgg agctcgccga ggtgcactcg       300
     gtccgccagg gcgcgccgcg cggcctcggg cacgccgtgc tgtgcggcgc cccgcacgtg       360
     ggtgacgagc cgttcgcggt gcttctcggc gacgacctga tcgatgagcg ggatccgctc       420
     ctcgaggaga tgctcgccgt gcaggagcgg ttcggcggca gcgtgatcgc gctgatggag       480
     gtgccggagg aggtcgtctc gctctacggc gtcgccaccg tggatccggc gccggtcgcg       540
     gccggcgggc gttacgagac cgtccgcatc cgcgacctgg tcgagaagcc gccggccgac       600
     gaggcgccga gcaatctggc gatcatcggc cgctatgtgc tcgcgcccaa ggtcttcgag       660
     gtgctgcgcc gcacgccgcc cggccgcggc ggcgagatcc agctgaccga cgcgctgcgg       720
     gagctggcgc aggccgccga cgaggtcggc gagcccgtgc acggcgtcgt gttcaccggg       780
     cgtcgctacg acaccggcga ccgggtcgac tacctgaagg ccgtcatccg gctggcctgc       840
     gagcgggccg acctgggccc cgagatctac ccgtggctgg aggagtacgt cgcgaacggc       900
     ggtccgaagg cggacaacta g                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page