(data stored in ACNUC7421 zone)

EMBL: CP002299.PE536

CP002299.PE536       Location/Qualifiers
FT   CDS_pept        678890..680182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0542"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: MoeA domain protein domain I and II; MoeA
FT                   domain protein domain IV; molybdopterin binding domain;
FT                   KEGG: fal:FRAAL6396 molybdopterin biosynthesis protein MoeA
FT                   2; SMART: molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78624"
FT                   /db_xref="GOA:E3JB94"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB94"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ADP78624.1"
FT                   /translation="MKTVDEHISDILESVGVLPARRLPLAAAHGCALATDVRATIALPG
FT                   FDNSAMDGYAVRAADVEQASPESPVLLPVTGEIAAGAALPDLVAPGTAVRIMTGAPFPP
FT                   GADTVIQLEWTDGGTETVAVHRAARRGLHIRRAGEDVTPGSLVLPAGSVLGSTQIGLLA
FT                   AINVARPPVRPRPRVAVLSTGSELVAVGNAVGPGQIVDSNSHAVAAAAREAGCEVRRLT
FT                   GVPDDPAQFEAALRAILPEVDAVVTTGGVSVGAHDVVKEVLAATGEVRFERIAMQPGQP
FT                   QGFGVIDGVAVFTLPGNPVSALVSFELFVRPALRRMRGLTGPDRPRPVVTVAERLTSPP
FT                   AKRSFLRVLVGRGADGGLVAQSAGGQGSHHLSAAAGANALLVVPEDVTVVEPGDQLTAI
FT                   LLAADPADELLAGPVVDAVPAGAVAPLEANV"
     atgaaaacgg tcgacgagca tatttcggac attctggaat ccgtcggggt actgcccgca        60
     cggcgccttc cgctggcggc cgcgcatggt tgcgccctgg ccaccgatgt tcgcgcgaca       120
     atcgcgctcc ccggtttcga caactcggcg atggatggtt acgcggtgcg cgccgcggac       180
     gtcgagcagg ccagtcctga gtcgccggtc ctgcttccgg tcaccggcga gatcgccgcg       240
     ggtgccgcgc ttccggacct ggtcgccccg ggaaccgccg tgcggatcat gacgggcgcc       300
     cccttcccgc ccggcgcgga cacggtcatt cagctcgaat ggaccgatgg cggcaccgag       360
     acggtcgccg tgcaccgggc ggcccggcgc ggcctgcaca tccgccgggc cggcgaggac       420
     gtcacccccg gcagcctggt gctcccggcc ggcagcgtgc tcgggtccac gcagatcggc       480
     ctgctcgccg cgatcaacgt cgcccggccg ccggtgcgcc cgcggccccg cgtcgccgtg       540
     ctgtcgaccg gcagcgagct ggtcgccgtc ggcaacgccg tcggccccgg ccagatcgtc       600
     gactcgaaca gccacgcggt cgccgcggcg gcccgcgagg ccggctgcga ggtgcggcgg       660
     ctgaccggcg tgcccgacga cccggcccag ttcgaggccg cgctgcgggc gatcctgccc       720
     gaggtggacg cggtcgtgac gaccggcggg gtgagtgtcg gcgcgcacga cgtcgtcaag       780
     gaggtgctcg ccgcgaccgg cgaggtccgg ttcgagcgga tcgccatgca gcccggccag       840
     ccgcagggct tcggtgtcat cgacggcgtc gccgtcttca cgctgccggg caacccggtg       900
     agcgcgctgg tctcgttcga gctgttcgtc cggccggcgt tgcgccggat gcgcggcctc       960
     accggcccgg accggccccg gccggtcgtc accgtggccg agcggctcac ctcgccgccg      1020
     gcgaagcgct cgttcctgcg ggtgctggtg ggccgtggcg ccgacggtgg gctcgtcgcc      1080
     cagtcggccg gtgggcaggg ctcccatcac ctgtccgccg ccgccggcgc gaacgcgctg      1140
     ctcgtcgtcc ccgaggacgt gaccgtcgtc gagcccggcg accagctgac cgccatcctg      1200
     ctcgcggccg acccggccga cgagctgctc gccggcccgg tggtcgacgc cgtgcccgcg      1260
     ggcgccgtgg ccccgctgga ggcgaacgtc tag                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page