(data stored in ACNUC7421 zone)

EMBL: CP002299.PE544

CP002299.PE544       Location/Qualifiers
FT   CDS_pept        689168..690421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0552"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rci:RRC32 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78632"
FT                   /db_xref="GOA:E3JBA2"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBA2"
FT                   /inference="similar to AA sequence:KEGG:RRC32"
FT                   /protein_id="ADP78632.1"
FT                   /translation="MSGEHRPTTAPPVDDGFATWLRAALAAQALDIELPATAGSSLLAR
FT                   AGAGDDPRLRTAPAARSPRRRWVATAVVAAAVLLVTVGAATLPRALRGHGDQVVPASVP
FT                   DMVAPTFYGVRVGWLPGEVQLYRDFLSAGIQIGGIATPGEAMNMESAEWATPAAIRARS
FT                   DSGSAASGGYSLLVIRAVANGGNVPSVKADTSTEQTTTVRGHIAVWASSRSPGNAGGSL
FT                   TWTVDFPAGTGGKATDHVFVQVLGPDETVVRRIADNLSVGPRPSGPTDKASAVAAMAAS
FT                   ASAAFDGASGVAMADAVDDPQAVLDGIGAALRTRPDALHAVSFAGVGPAPAGSQPDPRM
FT                   PQSVVVFLSDTEAQLSGVWIGGTTKEELAPATVPPNTTPPGMIDATIRFTLTSRGWKVG
FT                   RASFCGALVGVVTCPTNP"
     atgagcggcg agcatcggcc cacgacagct ccaccggtgg acgacgggtt cgcgacatgg        60
     cttcgggccg cacttgcggc gcaggccctg gacatcgaac tgcccgcgac ggccggatcg       120
     agtctgctcg cccgcgcagg tgccggcgac gacccacggc tccggacagc acccgccgcg       180
     aggtcgccgc ggcggcgctg ggttgccacg gcggtggtcg ccgcggccgt cctgctggtg       240
     accgtgggcg cggccacgct gccaagggcg ctgcgcggcc acggggacca ggtggtcccc       300
     gccagcgtgc cggacatggt cgccccgacg ttctatggcg tgcgggtcgg ctggcttccg       360
     ggcgaggtac agctctaccg cgacttcctc agcgccggga tccagatcgg aggcatcgcc       420
     acgccaggtg aggcgatgaa catggagagc gctgaatggg ccacgcctgc cgcaatccgc       480
     gctcgctcgg attccggcag cgcggcgagc ggcggatact cgctactcgt gatccgggcg       540
     gtggccaacg gcgggaacgt gcccagcgtc aaagccgaca catcgacaga acagacgacc       600
     acggttcgcg gacacatcgc agtgtgggcc agctcgaggt cgccgggcaa cgccgggggc       660
     agcctgacct ggaccgtcga cttccccgcc ggcaccggtg ggaaagcgac ggaccatgtc       720
     ttcgtccagg tcctcgggcc ggacgagacc gtcgtgcgcc ggatcgccga caacctgtcg       780
     gtcggcccgc gcccgtcggg tcccaccgac aaggccagcg cggtcgcggc gatggcagcc       840
     tcggccagcg ccgcgttcga tggtgccagc ggggtcgcga tggccgacgc ggtcgacgac       900
     ccgcaagcgg tactcgacgg gatcggcgcg gccctgcgca cgagacctga cgcgctgcat       960
     gcggtctcct tcgcgggcgt cggccccgcc ccggcgggca gccagccgga cccgcgcatg      1020
     ccgcagtctg tggtcgtgtt cctgtctgac accgaggccc agctgtccgg ggtgtggatc      1080
     ggggggacta cgaaggagga gctggccccc gcgaccgtgc cgccgaatac caccccgccg      1140
     ggaatgatcg acgccacgat ccgtttcacg ctcacatcgc gcgggtggaa ggtcggccgg      1200
     gcgtccttct gcggcgcact ggtcggcgtc gtcacctgcc ccaccaaccc atag            1254
//

If you have problems or comments...

PBIL Back to PBIL home page