(data stored in ACNUC7421 zone)

EMBL: CP002299.PE546

CP002299.PE546       Location/Qualifiers
FT   CDS_pept        complement(694150..694947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0554"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: cai:Caci_3623
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78634"
FT                   /db_xref="GOA:E3JBA4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBA4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADP78634.1"
FT                   /translation="MATPTPVIFIHGLWLHASSWGPWIDLFRTAGYDPSAPGWPGDPDT
FT                   VDEARADSQAMAGHGIDDVVAHYAEIISHLPVKPILVGHSFGGMIAQRLLGQDLAAAAV
FT                   AIDAAQIKGVLPLPLSALRATLPVFKNPSNRNKTVPLTAEQFRYAFGNTIPEDESQQLF
FT                   DTWVIPAPGKPLFEAAAANFDPHSPAAVNTKNEGRGPLLLIAGGKDHTVPEVVTRATLK
FT                   QYRHSSAVTDILDFADRGHSLTIDHGWRDVADASLDWLRKQGL"
     atggcaaccc ccactcccgt gatcttcatc catgggctct ggctgcacgc ctcgtcctgg        60
     ggcccctgga ttgacctgtt ccgcaccgcc ggctacgacc cctcggcccc cggctggccc       120
     ggcgaccccg acacggtgga cgaggccagg gccgactcgc aggccatggc cggccacggc       180
     atcgacgacg tcgtcgccca ctacgcggag atcatctcgc acctgccggt gaagccgatc       240
     ctggtcgggc actcgttcgg cgggatgatc gcccagcgcc tgctcggcca ggatctcgcc       300
     gccgcggcgg tcgcgatcga tgccgcccag atcaagggcg tgctgccgct gccgctctcg       360
     gcgctgcgcg cgaccctgcc ggtgttcaag aacccgagca acaggaacaa gaccgtcccg       420
     ctgacggcgg agcagttccg gtacgccttc gggaacacca ttcccgagga cgagtcccag       480
     cagctgttcg acacctgggt catcccggcg cccggcaagc ccctgttcga ggccgccgcg       540
     gccaacttcg acccccactc gccggcggcg gtcaacacca agaacgaggg ccgcggcccg       600
     ctcctgctga tcgccggagg gaaggaccac accgttccgg aggtggtcac ccgggccacc       660
     ctgaagcagt accgccactc cagcgcggtc accgacatcc tcgacttcgc cgaccgtggg       720
     cactcgctga cgatcgacca cggctggcgc gacgtcgcgg acgcgtcgct ggactggctg       780
     cgcaagcagg ggctgtaa                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page