(data stored in ACNUC7421 zone)

EMBL: CP002299.PE55

CP002299.PE55        Location/Qualifiers
FT   CDS_pept        61563..62177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0055"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78143"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3E1"
FT                   /inference="similar to AA sequence:KEGG:FRAAL1370"
FT                   /protein_id="ADP78143.1"
FT                   /translation="MVDVGPPSREEPDPTGSEPAGPGIQSAMVALIQDTRGDGSAVVRY
FT                   IQCDNCEGPTPHHAEVQIFSATSRNPTFVASPPEVVCGVCGSVHPRVVGDEPACDTRIT
FT                   CVARRVPRLPLDRLGLDRLRLDRLPLGRLRDRAGLDRLPFGRVLPDAVRQLRWPGACAH
FT                   RFLVPAAAPTVICPRCSSTQAGPPYRLRAPYPDQEPDPRNA"
     atggtggatg tggggccgcc cagtcgcgaa gagccggacc cgaccggttc cgagccggcc        60
     gggcctggca tccagtccgc catggtcgcg ctcatccagg acacccgtgg cgacgggtcg       120
     gcggtggtcc ggtacatcca gtgcgacaac tgcgaggggc cgactcccca ccacgccgag       180
     gtgcagatct tctcggccac ctcgcggaac ccgacgttcg tggcctcccc gcccgaggtc       240
     gtctgtggcg tctgcggttc ggtccatccc cgggtcgtgg gcgacgagcc ggcctgtgac       300
     accaggatca cctgcgtcgc ccgccgcgtg ccccgcctcc cgttggaccg cctcgggctg       360
     gaccgcctcc ggctggaccg cttgccgctg ggccggctac gcgaccgcgc cggcctggac       420
     cggctgccat tcggccgcgt cctgcccgac gcggtccgcc agctccggtg gcctggcgcc       480
     tgcgcccacc gcttcctggt accggcggcg gcgcccaccg tcatctgccc ccgctgctcg       540
     agcacccagg ccggcccccc gtaccgcctc cgcgccccct accccgacca ggaacccgac       600
     cccaggaacg cctga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page