(data stored in ACNUC7421 zone)

EMBL: CP002299.PE551

CP002299.PE551       Location/Qualifiers
FT   CDS_pept        702394..702564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0560"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cai:Caci_3373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78639"
FT                   /db_xref="GOA:E3JBA9"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBA9"
FT                   /inference="similar to AA sequence:KEGG:Caci_3373"
FT                   /protein_id="ADP78639.1"
FT                   /translation="MPLIIAILIVALLFGGLGFAVHALWIVALVVFVAWILGFVLRSGS
FT                   STGSRGRWYRW"
     atgccgctta ttatcgcgat cctgatcgtc gcgctgctgt tcggtggtct gggtttcgcc        60
     gtccacgctc tgtggattgt cgccctggtg gtcttcgtgg cctggatcct cggtttcgtc       120
     ctgcgttctg gcagcagcac cggtagcagg ggccgctggt atcgctggta a                171
//

If you have problems or comments...

PBIL Back to PBIL home page