(data stored in ACNUC7421 zone)

EMBL: CP002299.PE553

CP002299.PE553       Location/Qualifiers
FT   CDS_pept        704872..705552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0562"
FT                   /product="cutinase"
FT                   /note="PFAM: cutinase; KEGG: kra:Krad_4111 cutinase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78641"
FT                   /db_xref="GOA:E3JBB1"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBB1"
FT                   /inference="protein motif:PFAM:PF01083"
FT                   /protein_id="ADP78641.1"
FT                   /translation="MALKTGTLISFVAMAAAATGGGLAGCPGPSGGSGSNPANPAGCAD
FT                   VEVVFARGSGELPGLGITGTPFVSSLTSDLAGKSVTSYAVNYAADLAQTSAGAGATDMS
FT                   NHVVSVAAKCPNTEFVLGGYSQGASVTDIAIGIPTLLGSGTTIPASLAPRVAAVVVFGN
FT                   PLALYGQHIPTASSLYGSKAQEFCAAGDPVCANGANGVAHLSYPTNGMTTQGAAFAAAK
FT                   VKSS"
     atggcattga agacaggaac cctcatctcg ttcgtggcga tggccgcggc ggcgaccggc        60
     ggcggcctcg ccggttgtcc cgggccaagc ggcgggtcgg gctcgaaccc ggccaacccc       120
     gcaggctgtg ccgacgtcga ggtggtcttc gcccgcggca gcggtgagct gcccggcctc       180
     ggaatcaccg gcaccccgtt cgtcagctcg ttgacctccg atctcgccgg caagtcggtg       240
     acctcgtatg ccgtgaacta cgcggccgac ctcgcccaga cctcggccgg agccggtgcc       300
     accgacatgt cgaaccacgt cgtctcggtg gccgcgaaat gcccgaacac cgagttcgtc       360
     ctcggcgggt actcgcaggg cgcgagcgtc accgacatcg cgattggcat tcccaccctg       420
     ctgggcagcg gcacgacgat cccggccagc ctggccccgc gggtcgccgc cgtcgtcgtc       480
     ttcggcaacc cgttggcgct gtacgggcag cacatcccga ccgccagctc gctctacggc       540
     tcgaaggccc aggagttctg cgccgcgggc gaccccgtct gcgcgaacgg cgccaatggc       600
     gtcgcccacc tgagctaccc gaccaacggg atgaccacgc agggcgcggc cttcgccgcc       660
     gccaaggtca agagctcctg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page