(data stored in ACNUC7421 zone)

EMBL: CP002299.PE554

CP002299.PE554       Location/Qualifiers
FT   CDS_pept        705637..706077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0563"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: art:Arth_3902 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78642"
FT                   /db_xref="GOA:E3JBB2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBB2"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADP78642.1"
FT                   /translation="MTPEDLANLAHLRRARDLMDREYASPLDVAALARAALMSTAHFSR
FT                   QFRAAYGETPYSYLMTRRIERAKALLRRGDLSVTDVCMAVGCTSLGSFSARFTELVGET
FT                   PTAYRARDHGALAGVPGCVAKDLTRPSRRPSRIGEARGPAVP"
     gtgacgccgg aggacctcgc caacctcgcg cacctgcgtc gcgcccgcga cctgatggac        60
     cgcgagtacg ccagcccgct cgacgtggcc gcgctcgccc gggccgcgct gatgtcgacc       120
     gcgcacttct cccggcagtt ccgggccgcg tacggggaga cgccctactc ctacctgatg       180
     acccggcgca tcgagcgggc gaaggcgctg ctgcgccggg gcgacctgtc ggtcaccgac       240
     gtctgcatgg cggtcggctg tacctcgctc ggctcgttca gcgcgcgctt caccgagctc       300
     gtcggcgaga ccccgacggc ctaccgggcc cgcgaccacg gcgcgctcgc gggcgtgccg       360
     ggctgcgtcg ccaaggacct gacccgcccg agccgccgac cgagcaggat cggagaagcg       420
     cgcgggcctg cggttcctta g                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page