(data stored in ACNUC7421 zone)

EMBL: CP002299.PE555

CP002299.PE555       Location/Qualifiers
FT   CDS_pept        706088..706495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0564"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: art:Arth_3903
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78643"
FT                   /db_xref="GOA:E3JBB3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBB3"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADP78643.1"
FT                   /translation="MELTFARCFVQINDADLALAFYRDALGLEVRKDVANEGFRWITVG
FT                   AASQPGVEIVLTNFVQGSPSDVDVIAALVAKGAMGGVHFHTDDLDGTFEKVRATGAEVV
FT                   QEPTEQFWGTKDCAVRDPSGNLVRIDQLPAA"
     atggaactca cctttgcccg ctgcttcgtc cagatcaacg acgccgacct cgctctggcc        60
     ttctaccggg acgcgctggg cctcgaggtg cgcaaggacg tcgccaacga gggcttccgc       120
     tggatcaccg tcggcgccgc gtcccagccc ggcgtcgaga tcgtcctgac gaacttcgtg       180
     cagggcagcc cgtccgacgt cgacgtcatc gcggccctcg tcgccaaggg cgcgatgggc       240
     ggcgtccact tccacaccga cgacctcgac ggcaccttcg agaaggtgcg cgcgacgggc       300
     gccgaagtcg tccaggagcc gaccgagcag ttctggggca cgaaggactg cgccgtgcgt       360
     gacccgtccg gcaacctggt acgcatcgac cagctgcccg ccgcctga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page