(data stored in ACNUC7421 zone)

EMBL: CP002299.PE558

CP002299.PE558       Location/Qualifiers
FT   CDS_pept        complement(711829..713016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0568"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mav:MAV_2138 cytochrome
FT                   P450 superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78646"
FT                   /db_xref="GOA:E3JBB6"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBB6"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ADP78646.1"
FT                   /translation="MTELYWDPFDKDIDADPHPVWSRLRDEAPVYRNDKFDFYALSRYA
FT                   DVDGAHLDPATFSSAHGTVLEIMSPEPMDVGQMIFMDPPVHTTMRVLVSRAFTPRRVGG
FT                   MEGAIRAIAAELLDPLVGSGGFDYVQDFAALLPSMVISELIGVDPEDREEIRLTIDESL
FT                   HIDDDKGMINDISFAAQIKMHTYLSEQIEARRKKPRDDMMTALTEAEIKTPDGGTRRLS
FT                   TSEAADFTNLLISAGTETVARLLGWTGALLAEHPAARAELVGDPSLIRNALEETLRYEA
FT                   PSPVQGRFTKSDVELHGTTIPAGSKVLLLTGSAGRDERKYADADRYDIHRVVDSHVSFG
FT                   HGIHFCLGAGLARMESRVAVEETLLRFPNWDVDQANAVRVHTSTVRGYAKLPITF"
     gtgactgagc tgtactggga cccgttcgac aaggacatcg acgccgaccc gcacccggtg        60
     tggtcccggc tgcgggacga ggctccggtc taccgcaacg acaagttcga tttctacgcg       120
     ctgtcccggt acgccgacgt cgacggcgcg cacctggacc cggcgacgtt cagctcggcg       180
     cacggcaccg tcctggagat catgagcccg gagccgatgg acgtcgggca gatgatcttc       240
     atggacccgc ccgtccacac gaccatgcgg gtgctggtgt cccgagcgtt caccccgcgc       300
     cgcgtcggcg gcatggaggg cgcgatccgc gcgatcgccg ccgagctgct cgacccgctc       360
     gtcggctccg gtggtttcga ctacgtccag gacttcgcgg cgctgctgcc gtcgatggtg       420
     atctccgagc tgatcggcgt cgacccggag gaccgcgagg agatccggct cacgatcgac       480
     gagtcgctgc acatcgacga cgacaaaggc atgatcaacg acatctcgtt cgcggcgcag       540
     atcaagatgc acacgtacct ctccgagcag atcgaggccc ggcgcaagaa gccacgcgac       600
     gacatgatga ccgccctcac cgaggcggag atcaagacgc ccgacggcgg cacccgccgg       660
     ctgtcgacct cggaggcggc cgacttcacc aacctgctga tcagcgccgg taccgagacg       720
     gtcgcgcggc tgctcggctg gaccggtgcg ctgctggccg agcacccggc ggcccgcgcc       780
     gaactggtcg gcgacccgtc gctgatcagg aacgcgctgg aggagacgct gcgctacgag       840
     gcgccgtcac cggtccaggg gcggttcacc aagagcgacg tcgagctgca cgggaccacc       900
     atcccggccg gctcgaaggt cctgctgctc accggttccg ccggccggga cgaacgcaag       960
     tacgccgacg ccgaccggta cgacatccac cgcgtggtcg acagccacgt ctcgttcggc      1020
     cacggcatcc acttctgcct cggcgccggg ctcgcccgga tggaaagccg ggtggcggtg      1080
     gaggagaccc tgctccggtt cccgaactgg gacgtcgacc aggcgaacgc cgtgcgggtg      1140
     cacaccagca ccgtccgcgg ctacgcgaaa ctgcccatca cgttctga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page