(data stored in ACNUC7421 zone)

EMBL: CP002299.PE560

CP002299.PE560       Location/Qualifiers
FT   CDS_pept        713853..715046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0570"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mmi:MMAR_4753
FT                   cytochrome P450 189A7 Cyp189A7"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78648"
FT                   /db_xref="GOA:E3JBB8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBB8"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ADP78648.1"
FT                   /translation="MSNPSPVYWDPFDREIAEDPYPTYRRLRAEAPLYYNDRHDFYVLS
FT                   HWDDVNRSLVDWATFSSARGPILEVIKANIKIPPGTLLMEDPPIHDLHRRLLARVFTPR
FT                   RVMSLESEIRDFCVRCLDRLAGSASFDLMAEFANEVPMRVIGMLLGIPEADQAAVRERA
FT                   DAKLRTEPGKQMKVSAKALMDTDLFADYIDWRAAHPSDDLMTELLNAEFEDETGTTRTL
FT                   TREEILTYVTVLAGAGNETTARLIGWLVALLDRHPDQRADLVENPGLIPNTIEETLRFE
FT                   PTGHAIARYVTKDVELYGQTVPAGSAMMLLLASANRDERRWDGGECFDVRRKIDQHITF
FT                   GIGTHYCLGAALARLEGRIALEEILARFPTWDVDWDNSALSSTSTMRGWEHLPISVG"
     gtgagcaacc cgagcccggt gtactgggat ccgttcgacc gtgagatcgc cgaggatccc        60
     tacccgacct accggcggct gcgggccgag gcgccgctct actacaacga ccgccacgac       120
     ttctacgtgc tcagccactg ggacgacgtc aaccggtcac tggtcgactg ggccaccttc       180
     tcctcggcgc ggggcccgat cctcgaggtc atcaaggcga acatcaagat cccgccgggg       240
     acgctgctca tggaggaccc gccgatccac gacctccatc gccgcctgct cgcccgggtc       300
     ttcacgccgc ggcgggtgat gtcgctggaa tccgagatcc gggacttctg cgtccggtgc       360
     cttgatcgtc tcgccgggtc ggcgagcttc gacctgatgg ccgagttcgc caacgaggtc       420
     ccgatgcggg tcatcggcat gctgctcggc atcccggagg ccgaccaggc cgcggtccgg       480
     gagcgggccg acgccaagct gcgcaccgag cccgggaagc agatgaaggt gtccgcgaag       540
     gcgctgatgg acaccgacct gttcgccgac tacatcgact ggcgggccgc ccatccgtcc       600
     gacgacctca tgaccgaact gctgaacgcc gagttcgagg acgagacggg gacgacgcgc       660
     acgctcaccc gtgaggagat cctgacctac gtgaccgtgc tggccggtgc cggcaacgag       720
     acgaccgccc gcctgatcgg ctggctggtc gccctgctcg accggcaccc cgaccagcgc       780
     gcggacctgg tcgagaaccc cgggctgatc ccgaacacca tcgaggagac gctgcgcttc       840
     gagcccaccg gccacgcgat cgcccgctac gtcacgaagg acgtggagct ctacggccag       900
     acggtcccgg ccggcagcgc gatgatgttg ctgctggctt ccgccaaccg tgacgagcgg       960
     cgttgggacg gcggcgagtg tttcgatgtt cgtcgcaaga tcgaccagca catcaccttc      1020
     ggaatcggca ctcattactg cctcggcgcg gcgctggctc gactcgaagg ccgtattgcg      1080
     ctcgaggaga tcctcgcgcg ttttcccacc tgggacgtcg actgggacaa ctcggcgctg      1140
     tcctcgacct ccaccatgcg cggctgggag caccttccca tcagcgtcgg ctga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page