(data stored in ACNUC7421 zone)

EMBL: CP002299.PE562

CP002299.PE562       Location/Qualifiers
FT   CDS_pept        716232..716633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0572"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfa:Bfae_31870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78650"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBC0"
FT                   /inference="similar to AA sequence:KEGG:Bfae_31870"
FT                   /protein_id="ADP78650.1"
FT                   /translation="MLALALVAGCGRVDPNEGFPGFQDTLAPSGQAAGGADAASSDSGA
FT                   GQPTDAADQGAPRPVATPGPGSAPSAGSNGAAGAAATASAKVSPSGTAANHGPTAAVTT
FT                   SSIKLPVETTTPAAKPTTAKPTGGIVLPH"
     gtgctggcgt tggcgctcgt ggccggctgc gggcgggtcg acccgaacga gggctttccc        60
     ggatttcagg acacgctggc gccgtcgggg caggcggccg gcggtgcgga cgccgcgtcg       120
     tccgactccg gcgctggtca gccgacggac gcagccgacc agggcgcgcc gcggcccgtc       180
     gcgaccccgg gcccggggtc cgccccgtcg gccggctcga atggcgccgc cggcgccgcc       240
     gcgaccgcgt cggcgaaggt gagtccgtcg ggcacggcgg ccaaccacgg cccgaccgcg       300
     gcggtcacca ccagctcgat caagctcccc gtcgagacca ccactcccgc cgccaagccg       360
     acgaccgcga agccgaccgg cggcatcgtc ctgccgcact ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page