(data stored in ACNUC7421 zone)

EMBL: CP002299.PE563

CP002299.PE563       Location/Qualifiers
FT   CDS_pept        716798..717358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0573"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: mva:Mvan_4942
FT                   isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78651"
FT                   /db_xref="GOA:E3JBC1"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBC1"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADP78651.1"
FT                   /translation="MTTLADRPNTALLVVDVQTEVVAAAYDRDAVVANIRELVDEARRA
FT                   GVPVVWVRHSDESLVRGSAGWQIVAELVPDGGEPLVEKSYGDAFEATTLEDVLAGLGVG
FT                   RLVVAGAETDACIRSTLHGAFTRGYDAVLVSDAHTTGDRSAWGAPPPEQVIGHTNLYWT
FT                   YQTAPGRTAGTVATKDVGFGAAH"
     atgaccacac tggcggaccg gcccaacacg gcgcttctcg tggtggacgt gcagaccgag        60
     gtcgtcgccg cggcctatga ccgggacgcc gtcgtggcga acatccgtga gctcgtcgac       120
     gaggcccggc gggccggcgt gccggtggtc tgggtccggc actccgacga gagcctggtg       180
     cgcgggtcgg cgggctggca gatcgtcgcg gagctggttc ccgacggtgg tgaaccgctc       240
     gtcgagaaga gctacggcga cgccttcgag gccaccacgc tggaagacgt gctggcgggg       300
     ctcggggtag ggcggctggt cgtggccggc gccgagaccg atgcctgtat ccggtcgacg       360
     ttgcacggtg ccttcacccg gggctacgac gcggtcctcg tcagcgacgc gcacaccacc       420
     ggcgacagga gcgcctgggg tgcgccaccg ccggagcagg tcatcgggca caccaacctg       480
     tactggacct accagaccgc ccccggccgg accgccggca ccgtcgcgac caaggacgtc       540
     ggcttcggcg ccgcgcactg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page